![Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining in human testis and pancreas tissues using anti-PPM1G antibody. Corresponding PPM1G RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunohistochemistry-Paraffin-NBP1-87246-img0013.jpg "Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining in human testis and pancreas tissues using anti-PPM1G antibody. Corresponding PPM1G RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPM1G |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PP2C gamma/PPM1G Antibody (NBP1-87246)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPM1G |
![Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-PPM1G antibody NBP1-87246 (A) shows similar protein distribution across tissues to independent antibody NBP1-87245 (B).](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunohistochemistry-Paraffin-NBP1-87246-img0016.jpg "Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-PPM1G antibody NBP1-87246 (A) shows similar protein distribution across tissues to independent antibody NBP1-87245 (B).")
![Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PPM1G antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Western-Blot-NBP1-87246-img0015.jpg "Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-PPM1G antibody. Remaining relative intensity is presented.")
![Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Analysis using Anti-PPM1G antibody NBP1-87246 (A) shows similar pattern to independent antibody NBP1-87245 (B).](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Western-Blot-NBP1-87246-img0017.jpg "Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Analysis using Anti-PPM1G antibody NBP1-87246 (A) shows similar pattern to independent antibody NBP1-87245 (B).")
![Immunocytochemistry/Immunofluorescence: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87246-img0014.jpg "Immunocytochemistry/Immunofluorescence: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human lymph node.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunohistochemistry-Paraffin-NBP1-87246-img0019.jpg "Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human lymph node.")
![Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Western-Blot-NBP1-87246-img0009.jpg "Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87246] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunohistochemistry-Paraffin-NBP1-87246-img0011.jpg "Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunohistochemistry-Paraffin-NBP1-87246-img0012.jpg "Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/PP2C-gamma-PPM1G-Antibody-Immunohistochemistry-Paraffin-NBP1-87246-img0018.jpg "Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87246] - Staining of human cerebral cortex.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")