Novus Biologicals products are now on bio-techne.com

POLDIP2 Antibody

Name: POLDIP2 Antibody
Brand: Novus Biologicals
SKU: NBP2-88071
Price: 399 USD

Submit a Review

Images

(

Enlarge)

Western Blot: POLDIP2 Antibody [NBP2-88071] - WB Suggested Anti-POLDIP2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

POLDIP2 Antibody Summary

Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLDIP2. Peptide sequence: SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH The peptide sequence for this immunogen was taken from within the described region.
Clonality	Polyclonal
Host	Rabbit
Gene	POLDIP2
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions

Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS, 2% Sucrose
Preservative	0.09% Sodium Azide
Concentration	0.5 mg/ml
Purity	Affinity purified

Alternate Names for POLDIP2 Antibody

DKFZP586F1524
p38
PDIP38DKFZp586F1524,38 kDa DNA polymerase delta interaction protein
POLD4
polymerase (DNA-directed), delta interacting protein 2
polymerase delta interacting protein 38
polymerase delta-interacting protein 2

Background

POLDIP2 encodes a protein that interacts with the DNA polymerase delta p50 subunit. The encoded protein also interacts with proliferating cell nuclear antigen. Some transcripts of this gene overlap in a tail-to-tail orientation with the gene for tumor necrosis factor, alpha-induced protein 1 (TNFAIP1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

JNK1 Antibody
(228601) [Unconjugate

MAB17761

Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

ERK1 Antibody
(1E5) - BSA Free

NBP2-22203

Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free

Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free

(1 Publication)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

EphB2 Antibody
[Unconjugated]

AF467

Western Blot EphB2 Antibody [Unconjugated]

Immunocytochemistry EphB2 Antibody [Unconjugated]

(5 Reviews)

(62 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(813 Publications)

Species: Hu

Applications: BA

c-jun [p Ser63]
Antibody (1018Y) [Unc ...

MAB8930

Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

SGSM3 Antibody

NBP2-13304

Immunocytochemistry/ Immunofluorescence SGSM3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(49 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

IL-6 [HRP]

M6000B

(662 Publications)

Species: Mu

Applications: ELISA

p38 gamma/SAPK3
Antibody [Unconjugate

AF1347

Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]

Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]

(8 Publications)

Species: Hu, Mu, Rt

Applications: ICC, IHC, Simple Western, WB

c-Fos Antibody
(2H2)

NBP2-50037

Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)

(1 Review)

(20 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, KO, WB

MKK4/MEK4 Antibody
(OTI8A8)

NBP1-47839

Immunocytochemistry/ Immunofluorescence MKK4/MEK4 Antibody (OTI8A8)

(1 Review)

Species: Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

PSMC6 Antibody
(2C4)

H00005706-M02

Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, KD, WB

p38 alpha Antibody
[Unconjugated]

AF8691

Western Blot p38 alpha Antibody [Unconjugated]

Immunohistochemistry p38 alpha Antibody [Unconjugated]

(1 Review)

(11 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, Simple Western, WB

FosB/G0S3 Antibody
[Unconjugated]

AF2214

Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]

Species: Hu

Applications: ICC, IHC, WB

JunD Antibody
(512709)

MAB5526

(2 Publications)

Species: Hu, Mu

Applications: WB

JunB/AP-1 Antibody

NBP1-89544

Immunohistochemistry-Paraffin JunB/AP-1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

JNK2 Antibody
(252320) [Unconjugate

MAB1846

Knockout Validated JNK2 Antibody (252320) [Unconjugated]

Immunocytochemistry JNK2 Antibody (252320) [Unconjugated]

(2 Reviews)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, WB

POLDIP2 Antibody

NBP2-88071

Species: Hu

Applications: WB

Publications for POLDIP2 Antibody (NBP2-88071) (0)

There are no publications for POLDIP2 Antibody (NBP2-88071).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLDIP2 Antibody (NBP2-88071) (0)

There are no reviews for POLDIP2 Antibody (NBP2-88071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLDIP2 Antibody (NBP2-88071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional POLDIP2 Products

Blogs on POLDIP2

There are no specific blogs for POLDIP2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Rabbit Anti-Human/Mouse/Rat HSP60 Polyclonal Antibody (AF1800) using a 1:1000 dilution of HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Rabbit IgG Secondary Antibody [HRP]
HAF008

Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP]
NB7160

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

PDF Datasheet

Request CofA

Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our POLDIP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol

POLDIP2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

POLDIP2 Antibody

Species Glossary

Images

Product Details

Order Details

POLDIP2 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for POLDIP2 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for POLDIP2 Antibody (NBP2-88071) (0)

Reviews for POLDIP2 Antibody (NBP2-88071) (0)

Product General Protocols

Video Protocols

FAQs for POLDIP2 Antibody (NBP2-88071) (0)

Secondary Antibodies

Isotype Controls

Additional POLDIP2 Products

Blogs on POLDIP2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics