![Western Blot: PLOD3 Antibody [NBP1-81307] - Analysis in human cell lines SK-MEL-30 and HEK293 using Anti-PLOD3 antibody. Corresponding PLOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.](http://images.novusbio.com/fullsize/PLOD3-Antibody-Western-Blot-NBP1-81307-img0005.jpg "Western Blot: PLOD3 Antibody [NBP1-81307] - Analysis in human cell lines SK-MEL-30 and HEK293 using Anti-PLOD3 antibody. Corresponding PLOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLOD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Simple_Western_18969.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Western_Blot_19006.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images/af1060_mouse-decorin-affinity-purified-polyclonal-ab-8120255552891.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLOD3 |
![Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/PLOD3-Antibody-Immunohistochemistry-Paraffin-NBP1-81307-img0009.jpg "Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human appendix shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PLOD3-Antibody-Immunohistochemistry-Paraffin-NBP1-81307-img0007.jpg "Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human appendix shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human pancreas shows no positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/PLOD3-Antibody-Immunohistochemistry-Paraffin-NBP1-81307-img0008.jpg "Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human pancreas shows no positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/PLOD3-Antibody-Immunohistochemistry-Paraffin-NBP1-81307-img0010.jpg "Immunohistochemistry-Paraffin: PLOD3 Antibody [NBP1-81307] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.")
![Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Western_Blot_12490.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Flow_Cytometry_12540.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/mab7616_human-integrin-alpha-2b-cd41-mab-clone-2530a-flow-cytometry-2462022151722.jpg)
![Immunocytochemistry FABP6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP6_AF3880_Immunocytochemistry__Immunofluorescence_20097.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")