We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.

Name: PKC alpha Antibody (2F11)
Brand: Novus Biologicals
SKU: H00005578-M01
Price: 519 USD

Question

We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue.  I see that you have many antibodies, including several monoclonals.  I wanted to confirm with you that the following antibodies are specific for C-alpha.  NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143.  Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.

Accepted Answer

We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, Func, ICC/IF, IHC
Clone	2F11
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	PRKCA (NP_002728, 563 a.a. ~ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Localization	Cytoplasmic and Nuclear
Specificity	PRKCA - protein kinase C, alpha
Isotype	IgG1 Kappa
Clonality	Monoclonal
Host	Mouse
Gene	PRKCA
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Dilutions	ELISA Immunocytochemistry/ Immunofluorescence Immunohistochemistry Immunohistochemistry-Paraffin Proximity Ligation Assay Western Blot 1:500
Application Notes	Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

PKC alpha Antibody (2F11)

Species Glossary

Images

Product Details

Order Details

PKC alpha Antibody (2F11) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for PKC alpha Antibody (2F11)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PKC alpha Antibody (H00005578-M01) (0)

Reviews for PKC alpha Antibody (H00005578-M01) (0)

Product General Protocols

Video Protocols

FAQs for PKC alpha Antibody (H00005578-M01). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional PKC alpha Products

Research Areas for PKC alpha Antibody (H00005578-M01)

Blogs on PKC alpha.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	PRKCA
Entrez	5578(Human)
OMIM	176960(Human)
Uniprot	NP_002728(Human)