Home » Phosphodiesterase 4A/PDE4A » PDE4A Peptides and Proteins » Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Phosphodiesterase 4A/PDE4A.

Source: E. coli

Amino Acid Sequence: LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDE4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55923.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen

  • cAMP-specific 3'-5'-cyclic phosphodiesterase 4A
  • DPDE2
  • DPDE2cAMP-specific phosphodiesterase
  • EC 3.1.4
  • EC 3.1.4.17
  • PDE4
  • PDE46
  • PDE4A
  • Phosphodiesterase 4A
  • phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2)
  • phosphodiesterase 4A, cAMP-specific (dunce
  • phosphodiesterase 4A, cAMP-specific
  • phosphodiesterase E2 dunce homolog, Drosophila
  • phosphodiesterase isozyme 4

Background

Enzymes of the cAMP-dependent phosphodiesterase type 4 (PDE4) family are important in hydrolyzing cAMP produced by G-protein coupled receptor (GPCR) stimulated adenylyl cyclases. In brain, more than 90% of cAMP formed by the stimulation of GPCRs is hydrolyzed by PDE4 enzymes. PDE4 enzymes are also important molecular targets for a variety of therapeutic agents like antidepressants, anti-asthmatics, and anti-inflammatory drugs. PDE4 family comprises 4 genes (PDE4A, B, C and D); each exhibiting multiple isozymes due to alternate splicing that leads to a larger number of distinct PDE4 variants. Members of the PDE4 family are regulated/activated by phosphorylation/dephosphorylation by cAMP-dependent protein kinase A and phosphatases. Protein-protein interactions and cellular trafficking of PDE4A enzymes play an important role in cAMP compartmentalization and cAMP-dependent signaling. In brain members of the PDE4A, B and D family are associated with GPCRs (adrenergic and dopaminergic) signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ALDH7A1 Antibody
NBP2-15343
Immunocytochemistry/ Immunofluorescence ALDH7A1 Antibody
Western Blot ALDH7A1 Antibody
Immunohistochemistry-Paraffin ALDH7A1 Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Phosphodiesterase
4D Antibody
NB100-2462
Western Blot Phosphodiesterase 4D Antibody
Western Blot Phosphodiesterase 4D Antibody
Immunohistochemistry-Paraffin Phosphodiesterase 4D Antibody
(2 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, PEP-ELISA, WB
PDE4B Antibody
(OTI1D12)
NBP2-01171
Flow Cytometry PDE4B Antibody (OTI1D12)
Flow Cytometry PDE4B Antibody (OTI1D12)
Western Blot PDE4B Antibody (OTI1D12)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PDE5A Antibody
NBP1-86139
Immunohistochemistry-Paraffin PDE5A Antibody
Immunohistochemistry-Paraffin PDE5A Antibody
Immunohistochemistry-Paraffin PDE5A Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PDE3B Antibody
NBP3-12242
Immunohistochemistry-Paraffin PDE3B Antibody
Western Blot PDE3B Antibody
Western Blot PDE3B Antibody
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
PDE7A Antibody
NB300-639
Western Blot PDE7A Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
PDE4C Antibody
NBP3-12244
Immunohistochemistry-Paraffin PDE4C Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Ovalbumin Antibody
NB600-922
Western Blot Ovalbumin Antibody
Western Blot Ovalbumin Antibody
Western Blot Ovalbumin Antibody
(10 Publications)
Species: Ch
Applications: ELISA, IHC, IP, Single-Cell Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated Calreticulin Antibody - BSA Free
Western Blot Calreticulin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free
(28 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
PDE3A Antibody
NBP1-85645
Immunohistochemistry-Paraffin PDE3A Antibody
Immunohistochemistry-Paraffin PDE3A Antibody
Immunohistochemistry-Paraffin PDE3A Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RAPGEF3 Antibody -
BSA Free
NBP2-81767
Western Blot RAPGEF3 Antibody - BSA Free
Immunohistochemistry RAPGEF3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence RAPGEF3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
Phosphodiesterase
4A/PDE4A Recombinant ...
NBP2-55923PEP
Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP) (0)

There are no publications for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP) (0)

There are no reviews for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Phosphodiesterase 4A/PDE4A Products

Research Areas for Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen (NBP2-55923PEP)

Find related products by research area.

Blogs on Phosphodiesterase 4A/PDE4A

There are no specific blogs for Phosphodiesterase 4A/PDE4A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PDE4A