Home » Pentraxin 2/SAP » Pentraxin 2/SAP Proteins » Pentraxin 2/SAP Recombinant Protein Antigen

Pentraxin 2/SAP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Pentraxin 2/SAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APCS.

Source: E. coli

Amino Acid Sequence: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APCS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31392.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pentraxin 2/SAP Recombinant Protein Antigen

  • 9.5S alpha-1-glycoprotein
  • amyloid P component, serum
  • APCS
  • MGC88159
  • Pentraxin 2
  • PTX2
  • PTX2serum amyloid P-component
  • SAP
  • SAPpentaxin-related
  • Serum Amyloid P component

Background

Serum Amyloid P (SAP) is a non-fibrillar plasma glycoprotein that belongs to the pentraxin family. It is universally found in amyloid deposits and this is probably due to its specific calcium-dependent binding to motifs present on all types of amyloid fibrils. SAP is also found to prevent fibrillar breakdown by enzymes and it is believed that it helps maintains stability of the amyloid deposits (1,2). It has been shown that SAP binds monocytes with high avidity, but does not bind to erythrocytes, NK cells, T lymphocytes or B lymphocytes (3). SAP production can be induced by exposure to IL-1, IL-6 and IFN-beta. The SAP-inducing activity was neutralized by antibodies to each of the recombinant cytokines (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(71 Publications)
Species: Hu
Applications: ELISA
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot SH2D1A Antibody (1C9)
Flow Cytometry SH2D1A Antibody (1C9)
ELISA SH2D1A Antibody (1C9)
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Pentraxin 3/TSG-14
[Biotin]
DY1826
N/A Pentraxin 3/TSG-14 [Biotin]
(14 Publications)
Species: Hu
Applications: ELISA
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
Amylin Antibody
NBP2-33680
Immunohistochemistry Amylin Antibody
Immunohistochemistry-Paraffin Amylin Antibody
Immunohistochemistry-Paraffin Amylin Antibody
Species: Hu
Applications: IHC, IHC-P
PITX3 Antibody
NBP2-85481
Western Blot PITX3 Antibody
Western Blot PITX3 Antibody
Western Blot PITX3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
DAP1 Antibody -
BSA Free
NBP2-92897
Western Blot DAP1 Antibody - BSA Free
Immunohistochemistry-Paraffin DAP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DAP1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Aspartyl
Aminopeptidase Antibo
NBP1-91684
Immunohistochemistry-Paraffin Aspartyl Aminopeptidase Antibody
Immunohistochemistry-Paraffin Aspartyl Aminopeptidase Antibody
Immunohistochemistry-Paraffin Aspartyl Aminopeptidase Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SLAM/CD150 Antibody
AF4330
Flow Cytometry SLAM/CD150 Antibody
(1 Review)
Species: Mu
Applications: CyTOF-ready, Flow, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(33 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB

Publications for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP) (0)

There are no publications for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP) (0)

There are no reviews for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pentraxin 2/SAP Products

Research Areas for Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP)

Find related products by research area.

Blogs on Pentraxin 2/SAP

There are no specific blogs for Pentraxin 2/SAP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pentraxin 2/SAP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol APCS