![Western Blot: PDE10A Antibody (8J7E5) [NBP3-33383] - Western blot analysis of various lysates, using PDE10A Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp3-33383_rabbit-pde10a-mab-8j7e5-912202415133475.jpg "Western Blot: PDE10A Antibody (8J7E5) [NBP3-33383] - Western blot analysis of various lysates, using PDE10A Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 8J7E5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 439-779 of human PDE10A (NP_006652.1). Sequence: SICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | PDE10A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 88 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDE10A |
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Bioactivity FGF-9 [Unconjugated]](https://images.novusbio.com/images/protein/273-f9_recombinant-human-fgf-9-protein-bioactivity-2411202075619.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")