Novus Biologicals products are now on bio-techne.com

PCID2 Recombinant Protein Antigen

Images

 
There are currently no images for PCID2 Recombinant Protein Antigen (NBP2-49586PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

PCID2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCID2.

Source: E. coli

Amino Acid Sequence: MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTYA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PCID2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49586.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PCID2 Recombinant Protein Antigen

  • CSN12-like protein
  • DKFZp686C20226
  • F10
  • FLJ11305
  • FLJ99362
  • MGC16774
  • PCI domain containing 2
  • PCI domain-containing protein 2

Background

PCID2, also known as PCI domain-containing protein 2, belongs to the CSN12 family, is a protein with 4 isoforms ranging from a 376 amino acid that is 43 kDa to a 453 amino acid that is 52 kDa, regulates the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation necessary for B-cell survival. Disease research has shown correlation of this protein with malaria. This protein has been linked to the negative regulation of apoptotic process, regulation of mRNA stability, positive regulation of B cell differentiations, positive regulation of transcription, DNA-dependent and spleen development pathways where it interacts with KPNB1, SMAD2, BRF2, NEK6 and SHFM1 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
202-IL
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-25459
Species: Hu, Rt
Applications: WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
AF2338
Species: Hu
Applications: ICC, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for PCID2 Recombinant Protein Antigen (NBP2-49586PEP) (0)

There are no publications for PCID2 Recombinant Protein Antigen (NBP2-49586PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCID2 Recombinant Protein Antigen (NBP2-49586PEP) (0)

There are no reviews for PCID2 Recombinant Protein Antigen (NBP2-49586PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PCID2 Recombinant Protein Antigen (NBP2-49586PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCID2 Products

Research Areas for PCID2 Recombinant Protein Antigen (NBP2-49586PEP)

Find related products by research area.

Blogs on PCID2

There are no specific blogs for PCID2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PCID2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PCID2