![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Analysis in human fallopian tube and liver tissues using NBP1-85803 antibody. Corresponding PBX1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0011.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Analysis in human fallopian tube and liver tissues using NBP1-85803 antibody. Corresponding PBX1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PBX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Western_Blot_5126.jpg)
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
| Publication using NBP1-85803 | Applications | Species |
|---|---|---|
| Chiang J, Li X, Jin H et al. The molecular characteristics of low-grade and high-grade areas in desmoplastic infantile astrocytoma/ganglioglioma Neuropathology and applied neurobiology 2022-02-21 [PMID: 35191090] (IHC-P) | IHC-P |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PBX1 |
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-85803 (A) shows similar protein distribution across tissues to independent antibody NBP1-86151 (B).](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0010.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-85803 (A) shows similar protein distribution across tissues to independent antibody NBP1-86151 (B).")
![Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in human cell lines HeLa and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/PBX1-Antibody-Western-Blot-NBP1-85803-img0009.jpg "Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in human cell lines HeLa and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Immunocytochemistry/Immunofluorescence: PBX1 Antibody [NBP1-85803] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85803-img0003.jpg "Immunocytochemistry/Immunofluorescence: PBX1 Antibody [NBP1-85803] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0014.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.")
![Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PBX1-Antibody-Western-Blot-NBP1-85803-img0007.jpg "Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0012.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0013.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0015.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Western_Blot_5176.jpg)
![Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16339.jpg)
![Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Chromatin_Immunoprecipitation_11246.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")