![Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - detection against Immunogen (38.1 KDa) .](http://images.novusbio.com/fullsize/PADI4-Antibody-4D8-Western-Blot-H00023569-M01-img0001.jpg "Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - detection against Immunogen (38.1 KDa) .")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 4D8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PADI4 (NP_004247, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL |
| Specificity | peptidyl arginine deiminase, type IV |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PADI4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 21415415) |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PADI4 Antibody (H00023569-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PADI4 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: PADI4 Antibody (4D8) [H00023569-M01] - Analysis of monoclonal antibody to PADI4 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/PADI4-Antibody-4D8-Immunocytochemistry-Immunofluorescence-H00023569-M01-img0004.jpg "Immunocytochemistry/Immunofluorescence: PADI4 Antibody (4D8) [H00023569-M01] - Analysis of monoclonal antibody to PADI4 on HeLa cell . Antibody concentration 10 ug/ml.")
![Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - Detection of enzymatically active peptidyl arginine deiminase (PAD) in the synovial fluid (SF) of patients with rheumatoid arthritis (RA). A, Immunoblotting of albumin‐depleted SF samples from 8 RA patients shows presence of neutrophil elastase (NE), PAD4, & PAD2. B, PAD activity in the SF of patients with RA (n = 12) was significantly higher than that in the SF of patients with osteoarthritis (OA) (n = 9). C, PAD activity was observed in the OA SF & RA SF both at physiologic calcium concentrations & at higher calcium concentrations (5 mM). In B & C, symbols represent individual patients; horizontal bars show the median. D, PAD activity is significantly correlated with DNA levels in the SF of RA patients (n = 22). Data were analyzed using Spearman's rho test for correlation. ∗ = P < 0.05; ∗∗ = P < 0.01, by Mann‐Whitney U test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26245941), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00023569-m01_mouse-monoclonal-padi4-antibody-4d8-310202415482220.jpg "Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - Detection of enzymatically active peptidyl arginine deiminase (PAD) in the synovial fluid (SF) of patients with rheumatoid arthritis (RA). A, Immunoblotting of albumin‐depleted SF samples from 8 RA patients shows presence of neutrophil elastase (NE), PAD4, & PAD2. B, PAD activity in the SF of patients with RA (n = 12) was significantly higher than that in the SF of patients with osteoarthritis (OA) (n = 9). C, PAD activity was observed in the OA SF & RA SF both at physiologic calcium concentrations & at higher calcium concentrations (5 mM). In B & C, symbols represent individual patients; horizontal bars show the median. D, PAD activity is significantly correlated with DNA levels in the SF of RA patients (n = 22). Data were analyzed using Spearman's rho test for correlation. ∗ = P < 0.05; ∗∗ = P < 0.01, by Mann‐Whitney U test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26245941), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - Release of peptidyl arginine deiminases (PADs) into the supernatant during NETosis, & detection of enzymatically active PADs. A, DNA release in peripheral blood neutrophils from healthy donors that were left unstimulated or stimulated with 25 mM phorbol myristate acetate (PMA) was assessed for up to 240 minutes after stimulation. Bars show the mean ± SD of 8 samples per group. B, For isolation of neutrophil extracellular traps, supernatants (SN) of unstimulated (unst.) or stimulated (stim.) neutrophils were collected. Subsequently, the cells were washed 3 times with RPMI medium (W1–W3), & stimulated cells were incubated in the absence or presence of DNase I; unstimulated cells treated with DNase I served as a control. Bars show the mean ± SD DNA concentration (conc) in 7 samples per group. C, Proteins (PAD2, PAD4, & neutrophil elastase [NE]) were precipitated from the same supernatants of unstimulated or stimulated cells as described in B & analyzed by Western blotting. Citrullinated proteins (citr.prot.) were detected using chemical modification & anti–modified citrulline antibody. PAD2 & PAD4 antibodies were tested for cross‐reactivity using human (hu) recombinant PAD4 (rPAD4) (250 ng) & human skeletal muscle tissue lysate (15 μg). One representative blot of 4 independent experiments is shown for each group. D, PAD activity in supernatants of unstimulated & stimulated cells was compared. Symbols represent individual donors (n = 10); bars show the median. ∗ = P < 0.05; ∗∗ = P < 0.01, by Wilcoxon's matched pairs signed rank test. AFU = arbitrary fluorescence units; NS = not significant. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26245941), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00023569-m01_mouse-monoclonal-padi4-antibody-4d8-310202415485135.jpg "Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - Release of peptidyl arginine deiminases (PADs) into the supernatant during NETosis, & detection of enzymatically active PADs. A, DNA release in peripheral blood neutrophils from healthy donors that were left unstimulated or stimulated with 25 mM phorbol myristate acetate (PMA) was assessed for up to 240 minutes after stimulation. Bars show the mean ± SD of 8 samples per group. B, For isolation of neutrophil extracellular traps, supernatants (SN) of unstimulated (unst.) or stimulated (stim.) neutrophils were collected. Subsequently, the cells were washed 3 times with RPMI medium (W1–W3), & stimulated cells were incubated in the absence or presence of DNase I; unstimulated cells treated with DNase I served as a control. Bars show the mean ± SD DNA concentration (conc) in 7 samples per group. C, Proteins (PAD2, PAD4, & neutrophil elastase [NE]) were precipitated from the same supernatants of unstimulated or stimulated cells as described in B & analyzed by Western blotting. Citrullinated proteins (citr.prot.) were detected using chemical modification & anti–modified citrulline antibody. PAD2 & PAD4 antibodies were tested for cross‐reactivity using human (hu) recombinant PAD4 (rPAD4) (250 ng) & human skeletal muscle tissue lysate (15 μg). One representative blot of 4 independent experiments is shown for each group. D, PAD activity in supernatants of unstimulated & stimulated cells was compared. Symbols represent individual donors (n = 10); bars show the median. ∗ = P < 0.05; ∗∗ = P < 0.01, by Wilcoxon's matched pairs signed rank test. AFU = arbitrary fluorescence units; NS = not significant. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26245941), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
