Home » p70 S6 Kinase beta/S6K2 » p70 S6 Kinase beta/S6K2 Proteins » p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen

p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPS6KB2.

Source: E. coli

Amino Acid Sequence: VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPS6KB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87805.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • KLS
  • p70 ribosomal S6 kinase beta
  • p70 S6 Kinase beta
  • p70 S6KB
  • p70 S6K-beta
  • p70(S6K)-beta
  • p70-beta
  • P70-beta-1
  • P70-beta-2
  • p70-S6K 2
  • P70S6K2
  • p70S6Kb
  • ribosomal protein S6 kinase beta-2
  • ribosomal protein S6 kinase, 70kD, polypeptide 2,70 kDa ribosomal protein S6 kinase 2
  • ribosomal protein S6 kinase, 70kDa, polypeptide 2
  • RPS6KB2
  • S6K2
  • S6K-beta
  • S6K-beta2
  • S6K-beta-2
  • serine/threonine-protein kinase 14 beta
  • Serine/threonine-protein kinase 14B
  • SRK
  • STK14B
  • STK14BS6 kinase-related kinase

Background

S6K2 encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p70 S6 Kinase/S6K
Antibody [Unconjugate ...
AF8962
Western Blot p70 S6 Kinase/S6K Antibody [Unconjugated]
Simple Western p70 S6 Kinase/S6K Antibody [Unconjugated]
Immunohistochemistry p70 S6 Kinase/S6K Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Ribosomal Protein
S6/RPS6 [p Ser235, p ...
AF3918
Western Blot Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Simple Western Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Immunohistochemistry Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
SIGLECL12 Antibody
NBP2-20362
Western Blot SIGLECL12 Antibody
Immunohistochemistry-Paraffin SIGLECL12 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
Immunohistochemistry-Paraffin SI Sucrase-Isomaltase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (27514 ...
MAB2687
Western Blot PI 3-Kinase p110 delta Antibody (275144)
Western Blot PI 3-Kinase p110 delta Antibody (275144)
(3 Publications)
Species: Hu
Applications: WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
RSK1 [p Ser380]
Antibody (1024A) [Unc ...
MAB79671
Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PYK2/FAK2 Antibody
NBP3-12969
Western Blot PYK2/FAK2 Antibody
Immunocytochemistry/ Immunofluorescence PYK2/FAK2 Antibody
Immunoprecipitation PYK2/FAK2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(559 Publications)
Species: Hu
Applications: BA

Publications for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP) (0)

There are no publications for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP) (0)

There are no reviews for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p70 S6 Kinase beta/S6K2 Products

Research Areas for p70 S6 Kinase beta/S6K2 Protein (NBP1-87805PEP)

Find related products by research area.

Blogs on p70 S6 Kinase beta/S6K2

There are no specific blogs for p70 S6 Kinase beta/S6K2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p70 S6 Kinase beta/S6K2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RPS6KB2