Osteocalcin Antibody (190125) [Allophycocyanin] Summary
Immunogen |
Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818 |
Specificity |
Detects human Osteocalcin in direct ELISAs. |
Source |
N/A |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
BGLAP |
Purity |
Protein A or G purified from hybridoma culture supernatant |
Purity Statement |
Protein A or G purified from hybridoma culture supernatant |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Packaging, Storage & Formulations
Storage |
Protect from light. Do not freeze.- 12 months from date of receipt, 2 to 8 °C as supplied.
|
Buffer |
Supplied in a saline solution containing BSA and Sodium Azide. |
Preservative |
Sodium Azide |
Purity |
Protein A or G purified from hybridoma culture supernatant |
Notes
This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.
Background
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
- Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow
Publications for Osteocalcin Antibody (IC1419A) (0)
There are no publications for Osteocalcin Antibody (IC1419A).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Osteocalcin Antibody (IC1419A) (0)
There are no reviews for Osteocalcin Antibody (IC1419A).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Osteocalcin Antibody (IC1419A) (0)
Additional Osteocalcin Products
Blogs on Osteocalcin