Home » Nucleostemin » Nucleostemin Proteins » Nucleostemin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Nucleostemin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Nucleostemin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNL3.

Source: E. coli

Amino Acid Sequence: KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38325.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nucleostemin Recombinant Protein Antigen

  • C77032
  • E2IG3NNP47
  • estradiol-induced nucleotide binding protein
  • GNL3
  • guanine nucleotide binding protein-like 3 (nucleolar)
  • guanine nucleotide-binding protein-like 3
  • MGC800
  • Novel nucleolar protein 47
  • NSE2-induced gene 3 protein
  • Nucleolar GTP-binding protein 3
  • Nucleostemin

Background

Nucleostemin is a protein found in the nucleoli of embryonic stem cells, adult CNS stem cells, primitive cells in the bone marrow and cancer cells. It is not in the differentiated cells of most adult tissues. It has been suggested to play a role in controlling the cell-cycle progression in stem cells and cancer cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Fucosyltransferase
2/FUT2
7770-GT
Fucosyltransferase 2/FUT2
(2 Publications)
Species: Hu
Applications: EnzAct
SQLE Antibody -
Azide and BSA Free
NBP2-93808
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence SQLE Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(662 Publications)
Species: Mu
Applications: ELISA
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB
SHP-2/PTPN11 [p
Tyr542] Antibody [Unc ...
AF3790
Western Blot SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Simple Western SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Immunocytochemistry SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Nucleostemin
Recombinant Protein A ...
NBP2-38325PEP
Nucleostemin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP) (0)

There are no publications for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP) (0)

There are no reviews for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nucleostemin Products

Research Areas for Nucleostemin Recombinant Protein Antigen (NBP2-38325PEP)

Find related products by research area.

Blogs on Nucleostemin

There are no specific blogs for Nucleostemin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nucleostemin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GNL3