![Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis using Anti-NPLOC4 antibody NBP1-82166 (A) shows similar pattern to independent antibody NBP1-82165 (B).](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Western-Blot-NBP1-82166-img0013.jpg "Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis using Anti-NPLOC4 antibody NBP1-82166 (A) shows similar pattern to independent antibody NBP1-82165 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPLOC4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Luiz Alexandre Magno |
WB | Rat | 10/17/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for NPLOC4 Antibody (NBP1-82166)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPLOC4 |
![Immunocytochemistry/Immunofluorescence: NPLOC4 Antibody [NBP1-82166] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82166-img0004.jpg "Immunocytochemistry/Immunofluorescence: NPLOC4 Antibody [NBP1-82166] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82166-img0017.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.")
![Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Western-Blot-NBP1-82166-img0007.jpg "Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in human cell line A-549.")
![Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Western-Blot-NBP1-82166-img0008.jpg "Western Blot: NPLOC4 Antibody [NBP1-82166] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: NPLOC4 Antibody [NBP1-82166] - Whole cell lysate of PC12 using antibody against nuclear protein NPLOC4. Samples were run as triplicates. Image from verified customer review.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Western-Blot-NBP1-82166-img0011.jpg "Western Blot: NPLOC4 Antibody [NBP1-82166] - Whole cell lysate of PC12 using antibody against nuclear protein NPLOC4. Samples were run as triplicates. Image from verified customer review.")
![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82166-img0014.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82166-img0015.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82166-img0016.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82166] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.")
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
