![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82165] - Staining in human testis and pancreas tissues using anti-NPLOC4 antibody. Corresponding NPLOC4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82165-img0012.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82165] - Staining in human testis and pancreas tissues using anti-NPLOC4 antibody. Corresponding NPLOC4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYL |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPLOC4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NPLOC4 Antibody (NBP1-82165)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPLOC4 |
![Western Blot: NPLOC4 Antibody [NBP1-82165] - Analysis using Anti-NPLOC4 antibody NBP1-82165 (A) shows similar pattern to independent antibody NBP1-82166 (B).](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Western-Blot-NBP1-82165-img0013.jpg "Western Blot: NPLOC4 Antibody [NBP1-82165] - Analysis using Anti-NPLOC4 antibody NBP1-82165 (A) shows similar pattern to independent antibody NBP1-82166 (B).")
![Immunocytochemistry/Immunofluorescence: NPLOC4 Antibody [NBP1-82165] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82165-img0007.jpg "Immunocytochemistry/Immunofluorescence: NPLOC4 Antibody [NBP1-82165] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82165] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82165-img0010.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82165] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82165] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/NPLOC4-Antibody-Immunohistochemistry-Paraffin-NBP1-82165-img0011.jpg "Immunohistochemistry-Paraffin: NPLOC4 Antibody [NBP1-82165] - Staining of human testis shows high expression.")
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")