Nociceptin Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PNOC |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Nociceptin Antibody
Background
Nociceptin (Orphanin FQ, OFQ), a heptadecapeptide peptide, has been designated as an endogenous ligand for the ORL1 receptor. The amino acid sequence of nociceptin hashomology with other opioid peptides, especially the prodynorphin fragment dynorphin A, suggesting a close evolutionary relationship between the precursors. A diffuse distribution throughout the brain is seen with binding studies and in situ hybridization suggesting an extensive role for nociceptin in a multitude of CNS functions. Immunocytochemical localizations in rat spinal cord have demonstrated nociceptin abundance in superficial dorsal horn, lateral spinal nucleus and the region dorsal to the central canal. Nociceptin immunoreactivity was not affected by dorsal rhizotomy, indicating that in spinal cord the peptide is produced by central rather than primary afferent neurons. The localization is supported by its function in processing of nociceptive signals.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Publications for Nociceptin Antibody (NBP2-58314) (0)
There are no publications for Nociceptin Antibody (NBP2-58314).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nociceptin Antibody (NBP2-58314) (0)
There are no reviews for Nociceptin Antibody (NBP2-58314).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Nociceptin Antibody (NBP2-58314) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nociceptin Products
Research Areas for Nociceptin Antibody (NBP2-58314)
Find related products by research area.
|
Blogs on Nociceptin