Novus Biologicals products are now on bio-techne.com

NIP Recombinant Protein Antigen

Name: NIP Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-47356PEP
Price: 279 USD

Images

There are currently no images for NIP Protein (NBP2-47356PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NIP Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUOXA1. Source: E. coli Amino Acid Sequence: VAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DUOXA1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47356. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NIP Recombinant Protein Antigen

Dual oxidase activator 1
dual oxidase maturation factor 1 delta
dual oxidase maturation factor 1 gamma
dual oxidase maturation factor 1
FLJ32334
homolog of Drosophila Numb-interacting protein
mol
NIPdual oxidase maturation factor 1 alpha
Numb-interacting protein
NUMBIPdual oxidase maturation factor 1 beta

Background

NIP, also referred to as Dual oxidase maturation factor 1 (DUOXA1), contains a 38 kDa, a 54 kDa, and a 33 kDa isoform, and is involved in the maturation of the DUOX complex, which produces hydrogen peroxide for thyroid hormonogenesis. Current research is being conducted on NIP and its relation to several disorders and diseases, such as aortic valve insufficiency, hypothyroidism, thyroiditis, and breast cancer. NIP has not been found to interact with other proteins, but has been linked to the processes of protein transport and neuron differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DUOX1 Antibody

NB100-93521

(1 Review)

(3 Publications)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

NINL Antibody

NBP1-81451

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

MIPEP Antibody
(OTI5E7)

NBP2-45861

Immunofluorescence MIPEP Antibody (OTI5E7)

Immunohistochemistry MIPEP Antibody (OTI5E7)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Aquaporin-0
Antibody - BSA Free

NBP2-92773

Western Blot Aquaporin-0 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Transportin 1
Antibody (D45) - BSA

NB600-1397

Immunohistochemistry-Paraffin Transportin 1 Antibody (D45) - BSA Free

(1 Review)

(8 Publications)

Species: Bv, Ca, Hu, Pm, Mu, Rb

Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB

DUOX2 Antibody -
BSA Free

NB110-61576

(12 Publications)

Species: Ca, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

DUOXA2 Antibody

NBP2-57547

Species: Hu

Applications: IHC, IHC-P

PLK1 Antibody
(OTI1D4)

NBP1-48291

Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, IP, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

IL-3 [Unconjugated]

203-IL

(217 Publications)

Species: Hu

Applications: BA

CRAT Antibody

NBP1-86616

Immunohistochemistry-Paraffin CRAT Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

TIPRL Antibody
(OTI3D11)

NBP2-02269

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

GLYAT Antibody

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody

Species: Hu

Applications: IHC, IHC-P, WB

TIP60 Antibody

NBP2-24613

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, Simple Western, WB

ITFG1 Antibody
(936213) [Unconjugate

MAB89001

(1 Publication)

Species: Hu

Applications: CyTOF-ready, Flow

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

hnRNP C1 + C2
Antibody (CL2593)

NBP2-36776

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

GIPC1 Antibody

NBP1-91941

Immunohistochemistry-Paraffin GIPC1 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

NIP Recombinant
Protein Antigen

NBP2-47356PEP

Species: Hu

Applications: AC

Publications for NIP Protein (NBP2-47356PEP) (0)

There are no publications for NIP Protein (NBP2-47356PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIP Protein (NBP2-47356PEP) (0)

There are no reviews for NIP Protein (NBP2-47356PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NIP Protein (NBP2-47356PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NIP Products

Blogs on NIP

There are no specific blogs for NIP, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our NIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DUOXA1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

NIP Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

NIP Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for NIP Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for NIP Protein (NBP2-47356PEP) (0)

Reviews for NIP Protein (NBP2-47356PEP) (0)

FAQs for NIP Protein (NBP2-47356PEP) (0)

Additional NIP Products

Blogs on NIP

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics