![Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in human epididymis and skeletal muscle tissues. Corresponding NPC2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-84012-img0014.jpg "Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in human epididymis and skeletal muscle tissues. Corresponding NPC2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
jian li |
ICC | Human | 06/14/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPC2 |
![Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in human cell lines U2OS and HeLa using Anti-NPC2 antibody. Corresponding NPC2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Western-Blot-NBP1-84012-img0007.jpg "Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in human cell lines U2OS and HeLa using Anti-NPC2 antibody. Corresponding NPC2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Western-Blot-NBP1-84012-img0005.jpg "Western Blot: Niemann-Pick type C2 Antibody [NBP1-84012] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-84012-img0010.jpg "Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human epididymis shows high expression.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-84012-img0011.jpg "Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human epididymis shows high expression.")
![Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-84012-img0012.jpg "Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Niemann-Pick-type-C2-Antibody-Immunohistochemistry-Paraffin-NBP1-84012-img0013.jpg "Immunohistochemistry-Paraffin: Niemann-Pick type C2 Antibody [NBP1-84012] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.")
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![N/A HE4/WFDC2 [HRP]](https://images.novusbio.com/images2/HE4_DHE400_ELISA_113.jpg)
![N/A HE4/WFDC2 [HRP]](https://images.novusbio.com/images2/DATA_HE4_DHE400_ELISA_712.jpg)
![N/A HE4/WFDC2 [HRP]](https://images.novusbio.com/images2/DATA_HE4_DHE400_ELISA_713.jpg)
![Immunohistochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunohistochemistry_6668.jpg)
![Immunocytochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunocytochemistry__Immunofluorescence_23054.jpg)
![Western Blot Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Western_Blot_19580.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
