Home » Nicastrin » Nicastrin Proteins » Nicastrin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Nicastrin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Nicastrin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nicastrin.

Source: E. coli

Amino Acid Sequence: VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCSTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57365.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nicastrin Recombinant Protein Antigen

  • anterior pharynx-defective 2
  • APH2
  • ATAG1874
  • KIAA0253APH2
  • NCSTN
  • Nicastrin

Background

Nicastrin is a large protein that is a component of an enzyme called gamma-secretase, which is lodged in the cell's membrane. Nicastrin protein is physically associated with presenilin and plays an important role in stabilization and correct localization of presenilin to the membrane-bound gamma-secretase complex. Nicastrin also serves as a docking site for gamma-secretase substrates such as APP and Notch, directly binding to them and presenting them properly to gamma-secretase to ensure the correct cleavage process.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
PSENEN/PEN2
Antibody (JE41-28)
NBP2-75632
Flow Cytometry PSENEN/PEN2 Antibody (JE41-28)
Immunocytochemistry/ Immunofluorescence PSENEN/PEN2 Antibody (JE41-28)
Immunocytochemistry/ Immunofluorescence PSENEN/PEN2 Antibody (JE41-28)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
APH1A Antibody
NB100-74360
Western Blot APH1A Antibody
Immunocytochemistry/ Immunofluorescence APH1A Antibody
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
BACE-1 Antibody
(137612)
MAB931
Western Blot BACE-1 Antibody (137612)
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
Presenilin-2
Antibody (APS 26)
NB100-74513
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TFF1/pS2 Antibody
NBP1-90813
Immunohistochemistry-Paraffin TFF1/pS2 Antibody
Immunohistochemistry-Paraffin TFF1/pS2 Antibody
Immunohistochemistry-Paraffin TFF1/pS2 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(38 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Knockout Validated Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NFIC Antibody
(1C12-2A2)
H00004782-M01
Western Blot NFIC Antibody (1C12-2A2)
Immunocytochemistry/ Immunofluorescence NFIC Antibody (1C12-2A2)
Immunohistochemistry-Paraffin NFIC Antibody (1C12-2A2)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NFIB Antibody
NBP1-81000
Western Blot NFIB Antibody
Immunocytochemistry/ Immunofluorescence NFIB Antibody
(6 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, WB
NFIA Antibody
NBP1-81406
Immunocytochemistry/ Immunofluorescence NFIA Antibody
Immunohistochemistry-Paraffin NFIA Antibody
Immunohistochemistry-Paraffin NFIA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NFIX Antibody
NBP2-15039
Immunocytochemistry/ Immunofluorescence NFIX Antibody
Immunohistochemistry-Paraffin NFIX Antibody
Immunohistochemistry-Paraffin NFIX Antibody
(9 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Recombinant Human
Eco1 GST (N-Term) Pro ...
H00114799-P01
Other Recombinant Human Eco1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP) (0)

There are no publications for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP) (0)

There are no reviews for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nicastrin Products

Research Areas for Nicastrin Recombinant Protein Antigen (NBP2-57365PEP)

Find related products by research area.

Blogs on Nicastrin

There are no specific blogs for Nicastrin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nicastrin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NCSTN