NEK1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NEK1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for NEK1 Antibody
Background
Belonging to the NEK Ser/Thr protein kinase family, NEK1 plays an important role in the cell by responding to DNA damage. Molecular functions for NEK1 include protein serine/threonine kinase activity, protein tyrosine kinase activity, protein binding and ATP binding. More specifically, NEK1 is involved in cell cycle regulation, and the protein encoded by this gene is a serine/threonine kinase which is found in a centrosomal complex with FEZ1. Additionally, NEK1 also appears to possess tyrosine kinase activity and is involved in the control of meiosis and cilium assembly. NEK1 is known to interact with FEZ1, FEZ2, KIF3A, TSC2 and MRE11A. Common diseases for NEK1 include adenocarcinoma, cancer, short rib-polydactyly syndrome II and epithelial neoplasia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for NEK1 Antibody (NBP1-82883) (0)
There are no publications for NEK1 Antibody (NBP1-82883).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NEK1 Antibody (NBP1-82883) (0)
There are no reviews for NEK1 Antibody (NBP1-82883).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NEK1 Antibody (NBP1-82883) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NEK1 Products
Research Areas for NEK1 Antibody (NBP1-82883)
Find related products by research area.
|
Blogs on NEK1