![Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Necdin-Antibody-1B3-Western-Blot-H00004692-M02-img0014.jpg "Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 1B3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED |
| Specificity | NDN - necdin homolog (mouse) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NDN |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Necdin Antibody (H00004692-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Necdin-Antibody-1B3-Immunocytochemistry-Immunofluorescence-H00004692-M02-img0008.jpg "Immunocytochemistry/Immunofluorescence: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. Antibody concentration 1.5 ug/ml.](http://images.novusbio.com/fullsize/Necdin-Antibody-1B3-Immunohistochemistry-Paraffin-H00004692-M02-img0010.jpg "Immunohistochemistry-Paraffin: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. Antibody concentration 1.5 ug/ml.")
![Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi ( Cat # H00004692-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody (M02), clone 1B3 (Cat # H00004692-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/Necdin-Antibody-1B3-Western-Blot-H00004692-M02-img0011.jpg "Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi ( Cat # H00004692-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDN monoclonal antibody (M02), clone 1B3 (Cat # H00004692-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: Necdin Antibody (1B3) [H00004692-M02] - NDN monoclonal antibody (M02), clone 1B3 Analysis of NDN expression in HL-60.](http://images.novusbio.com/fullsize/Necdin-Antibody-1B3-Western-Blot-H00004692-M02-img0013.jpg "Western Blot: Necdin Antibody (1B3) [H00004692-M02] - NDN monoclonal antibody (M02), clone 1B3 Analysis of NDN expression in HL-60.")
![ELISA: Necdin Antibody (1B3) [H00004692-M02] - Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Necdin-Antibody-1B3-ELISA-H00004692-M02-img0015.jpg "ELISA: Necdin Antibody (1B3) [H00004692-M02] - Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.")
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Immunohistochemistry NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Immunohistochemistry_6685.jpg)
![Western Blot NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Western_Blot_17941.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
