![Western Blot: NDUFC2 Antibody [NBP1-88934] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2](http://images.novusbio.com/fullsize/NDUFC2-Antibody-Western-Blot-NBP1-88934-img0004.jpg "Western Blot: NDUFC2 Antibody [NBP1-88934] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.In Simple Western only 10-15 uL of the recommended dilution is used per data point. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFC2 Antibody (NBP1-88934)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFC2 |
![Immunohistochemistry: NDUFC2 Antibody [NBP1-88934] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.](http://images.novusbio.com/fullsize/NDUFC2-Antibody-Immunohistochemistry-NBP1-88934-img0003.jpg "Immunohistochemistry: NDUFC2 Antibody [NBP1-88934] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.")
![Simple Western: NDUFC2 Antibody [NBP1-88934] - Simple Western lane view shows a specific band for NDUFC2 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://images.novusbio.com/fullsize/NDUFC2-Antibody-Simple-Western-NBP1-88934-img0006.jpg "Simple Western: NDUFC2 Antibody [NBP1-88934] - Simple Western lane view shows a specific band for NDUFC2 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.")
![Simple Western: NDUFC2 Antibody [NBP1-88934] - Electropherogram image of the corresponding Simple Western lane view. NDUFC2 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.](http://images.novusbio.com/fullsize/NDUFC2-Antibody-Simple-Western-NBP1-88934-img0007.jpg "Simple Western: NDUFC2 Antibody [NBP1-88934] - Electropherogram image of the corresponding Simple Western lane view. NDUFC2 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.")
![Western Blot HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAI1_AF1048_Western_Blot_16818.jpg)
![Immunohistochemistry HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAI1_AF1048_Immunohistochemistry_18061.jpg)
![Simple Western HAI-1/HGFA Inhibitor 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAI1_AF1048_Simple_Western_18675.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![Flow Cytometry CEACAM6/CD66c Antibody (439424) [Unconjugated]](https://images.novusbio.com/images2/CEACAM6_MAB3934_Flow_Cytometry_15404.jpg)
![Flow Cytometry CEACAM6/CD66c Antibody (439424) [Unconjugated]](https://images.novusbio.com/images2/CEACAM-6_MAB3934_Flow_Cytometry_8423.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")