Home » NAP1 » NAP1 Proteins » NAP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NAP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NAP1 Protein (NBP2-33985PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAB3.

Source: E. coli

Amino Acid Sequence: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33985.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NAP1 Recombinant Protein Antigen

  • CG5330
  • dNap
  • dNap1
  • dNAP-1
  • MAP3K7IP3
  • MGC45404
  • mitogen-activated protein kinase kinase kinase 7 interacting protein 3
  • Mitogen-activated protein kinase kinase kinase 7-interacting protein 3
  • NAP1
  • Nap-1
  • NF-kappa-B-activating protein 1
  • NFkB activating protein 1
  • p56/dCAF-4
  • TAB-3
  • TAK1-binding protein 3
  • TGF-beta activated kinase 1/MAP3K7 binding protein 3
  • TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
  • TGF-beta-activated kinase 1-binding protein 3

Background

NAP1, also know as TAK1-binding protein 3 (TAB3), is a binding and regulatory subunit of the transforming growth factor-beta-activated kinase 1 (TAK1). NAP1 functions as an adaptor that mediates IL1 and TNF signaling pathways. Additionally it plays a role in the activation of the NF-kappaB pathway by functioning as receptors that bind polyubiquitin chains for the regulation of kinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CACNA1A Antibody
NBP3-30941
Immunohistochemistry CACNA1A Antibody
Species: Hu, Rt
Applications: IHC, WB
WASF1/WAVE1
Antibody
AF5514
Western Blot WASF1/WAVE1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot ACTR2 Antibody (1B10-C4)
Immunohistochemistry-Paraffin ACTR2 Antibody (1B10-C4)
Sandwich ELISA ACTR2 Antibody (1B10-C4)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
TAB2 Antibody
(HL1712) - Azide and ...
NBP3-25708
Western Blot TAB2 Antibody (HL1712) - Azide and BSA Free
Immunohistochemistry-Paraffin TAB2 Antibody (HL1712) - Azide and BSA Free
Western Blot TAB2 Antibody (HL1712) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NAP1L1 Antibody
NBP1-81162
Immunohistochemistry-Paraffin NAP1L1 Antibody
Immunohistochemistry-Paraffin NAP1L1 Antibody
Immunohistochemistry-Paraffin NAP1L1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
AICDA Antibody
NBP1-30955
Immunocytochemistry/ Immunofluorescence AICDA Antibody
Immunohistochemistry-Paraffin AICDA Antibody
Western Blot AICDA Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(184 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
BRICK1 Antibody -
Azide and BSA Free
NBP3-03514
Immunocytochemistry/ Immunofluorescence BRICK1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin BRICK1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin BRICK1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
TAK1 Antibody
NB100-56363
Immunohistochemistry-Paraffin TAK1 Antibody
Immunocytochemistry/ Immunofluorescence TAK1 Antibody
Immunocytochemistry/ Immunofluorescence TAK1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NAP1L4 Antibody
NBP2-36543
Immunoprecipitation NAP1L4 Antibody
Western Blot NAP1L4 Antibody
Species: Hu
Applications: IP, WB
NCKAP1 Antibody
NBP2-19491
Immunohistochemistry-Frozen NCKAP1 Antibody
Immunohistochemistry-Paraffin NCKAP1 Antibody
Western Blot NCKAP1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
H2A Antibody (4C10)
H00008337-M01
Immunocytochemistry/ Immunofluorescence H2A Antibody (4C10)
Species: Hu
Applications: ELISA, ICC/IF, WB
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA H4/n Antibody (3E7H2) - BSA Free
Western Blot H4/n Antibody (3E7H2) - BSA Free
Flow Cytometry H4/n Antibody (3E7H2) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TBK1 Antibody
(108A429) - BSA Free
NB100-56705
Immunohistochemistry-Paraffin TBK1 Antibody (108A429) - BSA Free
Immunocytochemistry/ Immunofluorescence TBK1 Antibody (108A429) - BSA Free
Simple Western TBK1 Antibody (108A429) - BSA Free
(2 Reviews)
(29 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
CYFIP1 Antibody
NBP2-16060
Immunocytochemistry/ Immunofluorescence CYFIP1 Antibody
Western Blot CYFIP1 Antibody
Western Blot CYFIP1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for NAP1 Protein (NBP2-33985PEP) (0)

There are no publications for NAP1 Protein (NBP2-33985PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAP1 Protein (NBP2-33985PEP) (0)

There are no reviews for NAP1 Protein (NBP2-33985PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NAP1 Protein (NBP2-33985PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAP1 Products

Array NBP2-33985PEP

Research Areas for NAP1 Protein (NBP2-33985PEP)

Find related products by research area.

Blogs on NAP1

There are no specific blogs for NAP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
CXCL8/IL-8 Antibody (6217) [Unconjugated]
MAB208-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NAP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TAB3