![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining in human skeletal muscle and heart muscle tissues using anti-MYOZ1 antibody. Corresponding MYOZ1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0009.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining in human skeletal muscle and heart muscle tissues using anti-MYOZ1 antibody. Corresponding MYOZ1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYOZ1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-85439 | Applications | Species |
|---|---|---|
| Ravel-Chapuis A, Belanger G et al. Misregulation of calcium-handling proteins promotes hyperactivation of calcineurin-NFAT signaling in skeletal muscle of DM1 mice. Hum Mol Genet 2017-06-15 [PMID: 28369518] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Myozenin 1 Antibody (NBP1-85439)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYOZ1 |
![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human cerebral cortex, liver, skeletal muscle and testis using Anti-MYOZ1 antibody NBP1-85439 (A) shows similar protein distribution across tissues to independent antibody NBP2-38412 (B).](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0010.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human cerebral cortex, liver, skeletal muscle and testis using Anti-MYOZ1 antibody NBP1-85439 (A) shows similar protein distribution across tissues to independent antibody NBP2-38412 (B).")
![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human testis.](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0012.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human heart muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0006.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human heart muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0007.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human skeletal muscle shows high expression.")
![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0011.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human liver.](http://images.novusbio.com/fullsize/Myozenin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85439-img0013.jpg "Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human liver.")
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Western_Blot_5701.jpg)
![Simple Western MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images2/MuRF1_AF5366_Simple_Western_17120.jpg)
![Western Blot MuRF1/TRIM63 Antibody [Unconjugated]](https://images.novusbio.com/images/af5366_human-mouse-rat-murf1-trim63-affinity-purified-polyclonal-ab-41202412402520.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")