Home » mpp8 » mpp8 Proteins » mpp8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

mpp8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for mpp8 Protein (NBP1-92136PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

mpp8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPHOSPH8.

Source: E. coli

Amino Acid Sequence: KRHDSDKEEKGRKEPKGLKTLKEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MPHOSPH8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92136.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for mpp8 Recombinant Protein Antigen

  • FLJ35237
  • HSMPP8
  • M-phase phosphoprotein 8
  • M-phase phosphoprotein, mpp
  • M-phase phosphoprotein, mpp8
  • mpp8
  • TWA3
  • Two hybrid-associated protein 3 with RanBPM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
GLP/EHMT1 Antibody
(B0422) [Unconjugated ...
PP-B0422-00
GLP/EHMT1 Antibody (B0422) [Unconjugated]
(5 Reviews)
(19 Publications)
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
GOLGA6 Antibody
NB100-2436
Immunohistochemistry-Paraffin GOLGA6 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
RCBTB1 Antibody
NBP2-20116
Western Blot RCBTB1 Antibody
Western Blot RCBTB1 Antibody
Immunohistochemistry-Paraffin RCBTB1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Lysine
(K)-specific Demethyl ...
NB110-40585
Immunoprecipitation Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody
Western Blot Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody
Western Blot Lysine (K)-specific Demethylase 4A/KDM4A/JMJD2A Antibody
(2 Reviews)
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
DNMT3A Antibody
(64B1446) - BSA Free
NB120-13888
Western Blot DNMT3A Antibody (64B1446) - BSA Free
Flow Cytometry DNMT3A Antibody (64B1446) - BSA Free
Flow Cytometry DNMT3A Antibody (64B1446) - BSA Free
(3 Reviews)
(124 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, KO, WB
SETDB1 Antibody
NBP2-20322
Immunohistochemistry-Paraffin SETDB1 Antibody
Western Blot SETDB1 Antibody
Immunocytochemistry/ Immunofluorescence SETDB1 Antibody
(4 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, WB
Ran Antibody
(8D1A6) - BSA Free
NBP2-61832
ELISA Ran Antibody (8D1A6) - BSA Free
Flow Cytometry Ran Antibody (8D1A6) - BSA Free
Immunocytochemistry/ Immunofluorescence Ran Antibody (8D1A6) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RAG2 Antibody
NBP2-43666
Immunocytochemistry/ Immunofluorescence RAG2 Antibody
Immunohistochemistry-Paraffin RAG2 Antibody
Western Blot RAG2 Antibody
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
G9a/EHMT2 Antibody
(A8620A) [Unconjugate ...
PP-A8620A-00
Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
(17 Publications)
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
HP1 alpha Antibody
NB100-2518
Flow (Intracellular) HP1 alpha Antibody
Immunocytochemistry/ Immunofluorescence HP1 alpha Antibody
Western Blot HP1 alpha Antibody
Species: Hu
Applications: Flow-IC, ICC/IF, WB
alpha-Defensin 1
[Biotin]
DY8198-05
N/A alpha-Defensin 1 [Biotin]
(5 Publications)
Species: Hu
Applications: ELISA
Mkln1 Antibody
NBP1-80655
Immunohistochemistry-Paraffin Mkln1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
RANBP9 Antibody
(4P10V6)
NBP3-15702
Immunohistochemistry-Paraffin RANBP9 Antibody (4P10V6)
Western Blot RANBP9 Antibody (4P10V6)
Immunohistochemistry-Paraffin RANBP9 Antibody (4P10V6)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
53BP1 Antibody -
BSA Free
NB100-304
Western Blot 53BP1 Antibody - BSA Free
Knockout Validated 53BP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 53BP1 Antibody - BSA Free
(14 Reviews)
(754 Publications)
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
TDRD7 Antibody
NBP1-87315
Immunohistochemistry TDRD7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P

Publications for mpp8 Protein (NBP1-92136PEP) (0)

There are no publications for mpp8 Protein (NBP1-92136PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mpp8 Protein (NBP1-92136PEP) (0)

There are no reviews for mpp8 Protein (NBP1-92136PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for mpp8 Protein (NBP1-92136PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional mpp8 Products

Research Areas for mpp8 Protein (NBP1-92136PEP)

Find related products by research area.

Blogs on mpp8

There are no specific blogs for mpp8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Total protein from HeLa, A431, Neuro2A, and PC12 was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL in 5% block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence. The observed molecular weight for these samples are ~250 kDa and the theoretical molecular weight is 214 kDa.
53BP1 Antibody - BSA Free
NB100-304

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our mpp8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MPHOSPH8