Home » MLYCD » MLYCD Proteins » MLYCD Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MLYCD Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MLYCD Protein (NBP1-83247PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MLYCD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLYCD.

Source: E. coli

Amino Acid Sequence: KEHGRNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLYCD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83247.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLYCD Recombinant Protein Antigen

  • EC 4.1.1.9
  • hMCD
  • malonyl-CoA decarboxylase
  • malonyl-CoA decarboxylase, mitochondrial
  • MCD
  • MCDmalonyl coenzyme A decarboxylase
  • MGC59795
  • MLYCD

Background

The product of this gene catalyzes the breakdown of malonyl-CoA to acetyl-CoA and carbon dioxide. Malonyl-CoA is an intermediate in fatty acid biosynthesis, and also inhibits the transport of fatty acyl CoAs into mitochondria. Consequently, the encoded protein acts to increase the rate of fatty acid oxidation. It is found in mitochondria, peroxisomes, and the cytoplasm. Mutations in this gene result in malonyl-CoA decarboyxlase deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(665 Publications)
Species: Mu
Applications: ELISA
Alpha Actinin 4
Antibody (4D10)
H00000081-M01
ELISA Alpha Actinin 4 Antibody (4D10)
Western Blot Alpha Actinin 4 Antibody (4D10)
Immunocytochemistry/ Immunofluorescence Alpha Actinin 4 Antibody (4D10)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
OXSM Antibody
NBP1-84732
Western Blot OXSM Antibody
Immunohistochemistry-Paraffin OXSM Antibody
Immunohistochemistry-Paraffin OXSM Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Endostatin [HRP]
DNST0
N/A Endostatin [HRP]
N/A Endostatin [HRP]
(22 Publications)
Species: Hu
Applications: ELISA
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
(12 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MLYCD Recombinant
Protein Antigen
NBP1-83247PEP
MLYCD Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MLYCD Protein (NBP1-83247PEP) (0)

There are no publications for MLYCD Protein (NBP1-83247PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLYCD Protein (NBP1-83247PEP) (0)

There are no reviews for MLYCD Protein (NBP1-83247PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLYCD Protein (NBP1-83247PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLYCD Products

Blogs on MLYCD

There are no specific blogs for MLYCD, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLYCD Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MLYCD