![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining in human cerebral cortex and pancreas tissues using anti-MLF2 antibody. Corresponding MLF2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0011.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining in human cerebral cortex and pancreas tissues using anti-MLF2 antibody. Corresponding MLF2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGA |
| Predicted Species | Mouse (96%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MLF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MLF2 Antibody (NBP1-82518)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MLF2 |
![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human cerebral cortex, kidney, liver and testis using Anti-MLF2 antibody NBP1-82518 (A) shows similar protein distribution across tissues to independent antibody NBP1-82519 (B).](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0013.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human cerebral cortex, kidney, liver and testis using Anti-MLF2 antibody NBP1-82518 (A) shows similar protein distribution across tissues to independent antibody NBP1-82519 (B).")
![Western Blot: MLF2 Antibody [NBP1-82518] - Analysis in control (vector only transfected HEK293T lysate) and MLF2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/MLF2-Antibody-Western-Blot-NBP1-82518-img0012.jpg "Western Blot: MLF2 Antibody [NBP1-82518] - Analysis in control (vector only transfected HEK293T lysate) and MLF2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: MLF2 Antibody [NBP1-82518] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82518-img0008.jpg "Immunocytochemistry/Immunofluorescence: MLF2 Antibody [NBP1-82518] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human testis.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0016.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human testis.")
![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0009.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0010.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human kidney.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0014.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human liver.](http://images.novusbio.com/fullsize/MLF2-Antibody-Immunohistochemistry-Paraffin-NBP1-82518-img0015.jpg "Immunohistochemistry-Paraffin: MLF2 Antibody [NBP1-82518] - Staining of human liver.")
![SDS-PAGE Netrin-1 [Unconjugated]](https://images.novusbio.com/images2/Netrin-1_1109-N1_779.jpg)
![Western Blot UNC5H2/UNC5B Antibody [Unconjugated]](https://images.novusbio.com/images2/UNC5H2_AF1006_Western_Blot_17311.jpg)
![Immunohistochemistry UNC5H2/UNC5B Antibody [Unconjugated]](https://images.novusbio.com/images2/af1006_rat-unc5h2-unc5b-affinity-purified-polyclonal-ab-immunohistochemistry-3152022161010.jpg)
![Western Blot UNC5H2/UNC5B Antibody [Unconjugated]](https://images.novusbio.com/images/af1006_rat-unc5h2-unc5b-affinity-purified-polyclonal-ab-822024950324.jpg)
![Immunohistochemistry Neogenin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neogenin_AF1079_Immunohistochemistry_17347.jpg)
![Western Blot Neogenin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neogenin_AF1079_Western_Blot_19964.jpg)
![Simple Western Neogenin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neogenin_AF1079_Simple_Western_20102.jpg)
![Immunohistochemistry DCC Antibody [Unconjugated]](https://images.novusbio.com/images2/af844_mouse-dcc-affinity-purified-polyclonal-ab-immunohistochemistry-21102022151713.jpg)
![Immunohistochemistry UNC5H3/UNC5C Antibody (200414) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1005_human-unc5h3-mab-clone-200414-immunohistochemistry-1882021132046.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Slit1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Slit1 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")