Home » MGMT » MGMT Proteins » MGMT Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MGMT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MGMT Recombinant Protein Antigen (NBP2-58611PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MGMT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGMT.

Source: E. coli

Amino Acid Sequence: PILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MGMT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58611.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MGMT Recombinant Protein Antigen

  • 6-O-methylguanine-DNA methyltransferase
  • EC 2.1.1.63
  • methylated-DNA--protein-cysteine methyltransferase
  • methylguanine-DNA methyltransferase
  • MGMT
  • O-6-methylguanine-DNA methyltransferase
  • O6-methylguanine-DNA methyltransferase
  • O-6-methylguanine-DNA-alkyltransferase

Background

O6-Methylguanine-DNA Methyltransferase (MGMT) is an important DNA repair protein involved in tumor cell resistance to the cytotoxic activity of chemotherapeutic alkylating agents. This protein is also effective in protecting normal cells against the genotoxic and carcinogenic effects of DNA alkylation. The alkylating drug resistance is caused by MGMT's ability to remove DNA alkyl groups introduced in the O6 position of guanine. MGMT is expressed in highly variable amounts, depending upon the cell and tissue type, species, and cellular growth characteristics. In addition, MGMT activity varies among groups of tumors and within a particular type of tumor.

MGMT antibodes are useful tools for DNA repair studies and for some cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry MLH1 Antibody (SP08-04)
Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)
Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
RASSF1 Antibody
(OTI2B11)
NBP2-03644
Flow Cytometry RASSF1 Antibody (OTI2B11)
Western Blot RASSF1 Antibody (OTI2B11)
Immunohistochemistry-Paraffin RASSF1 Antibody (OTI2B11)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(136 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
DAP Kinase 1
Antibody (SR1225)
NBP3-21649
Immunohistochemistry DAP Kinase 1 Antibody (SR1225)
Western Blot DAP Kinase 1 Antibody (SR1225)
Immunocytochemistry/ Immunofluorescence DAP Kinase 1 Antibody (SR1225)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DNA Ligase IV
Antibody
NBP2-16182
Western Blot DNA Ligase IV Antibody
Immunohistochemistry-Paraffin DNA Ligase IV Antibody
Immunocytochemistry/ Immunofluorescence DNA Ligase IV Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MSP/MST1
[Unconjugated]
352-MS
MSP/MST1 [Unconjugated]
(9 Publications)
Species: Hu
Applications: BA, BA
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Invadolysin
Antibody
NBP1-92025
Western Blot Invadolysin Antibody
Western Blot Invadolysin Antibody
Immunohistochemistry-Paraffin Invadolysin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
TMPRSS13 GST (N-Term) ...
H00084000-Q01
SDS-PAGE Recombinant Human TMPRSS13 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Coagulation Factor
XIV/Protein C Antibod ...
NBP1-86509
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
Immunohistochemistry-Paraffin Coagulation Factor XIV/Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Isocitrate
Dehydrogenase 1/IDH1 ...
MAB7049
Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]
Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]
Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]
(6 Publications)
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
SF3B14 Antibody
NBP1-87431
Immunocytochemistry/ Immunofluorescence SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
Immunohistochemistry-Paraffin SF3B14 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/ Immunofluorescence ROBLD3 Antibody
Immunohistochemistry ROBLD3 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for MGMT Recombinant Protein Antigen (NBP2-58611PEP) (0)

There are no publications for MGMT Recombinant Protein Antigen (NBP2-58611PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGMT Recombinant Protein Antigen (NBP2-58611PEP) (0)

There are no reviews for MGMT Recombinant Protein Antigen (NBP2-58611PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MGMT Recombinant Protein Antigen (NBP2-58611PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MGMT Products

Research Areas for MGMT Recombinant Protein Antigen (NBP2-58611PEP)

Find related products by research area.

Blogs on MGMT

There are no specific blogs for MGMT, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MGMT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MGMT