Home » MCAT » MCAT Proteins » MCAT Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MCAT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MCAT Protein (NBP1-83936PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MCAT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MCAT.

Source: E. coli

Amino Acid Sequence: HKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MCAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83936.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCAT Recombinant Protein Antigen

  • EC 2.3.1.39
  • fabD
  • FASN2C
  • malonyl CoA:ACP acyltransferase (mitochondrial)
  • malonyl-CoA:acyl carrier protein transacylase, mitochondrial
  • malonyl-CoA-acyl carrier protein transacylase, mitochondrial
  • MCT[Acyl-carrier-protein] malonyltransferase
  • Mitochondrial malonyltransferase
  • MTMGC47838
  • NET62

Background

MCAT is encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Metallothionein-2A
Antibody (6G2)
H00004502-M01
ELISA Metallothionein-2A Antibody (6G2)
Immunocytochemistry/ Immunofluorescence Metallothionein-2A Antibody (6G2)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Lactase Antibody
NBP3-12238
Immunohistochemistry-Paraffin Lactase Antibody
Immunohistochemistry-Paraffin Lactase Antibody
Immunohistochemistry-Paraffin Lactase Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
Metallothionein-3
Antibody
NBP1-89772
Immunocytochemistry/ Immunofluorescence Metallothionein-3 Antibody
Immunohistochemistry-Paraffin Metallothionein-3 Antibody
Immunohistochemistry-Paraffin Metallothionein-3 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(637 Publications)
Species: Mu
Applications: ELISA
Recombinant Human
Metallothionein-1A GS ...
H00004489-P01
SDS-PAGE Recombinant Human Metallothionein-1A GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
ALG1 Antibody
NBP2-32539
Immunocytochemistry/ Immunofluorescence ALG1 Antibody
Immunohistochemistry-Paraffin ALG1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Chymase/CMA1/Mast
Cell Chymase Antibody ...
MAB4099
Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]
ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IP, WB
MCT1/SLC16A1
Antibody - BSA Free
NBP1-59656
Western Blot MCT1/SLC16A1 Antibody - BSA Free
Knockdown Validated MCT1/SLC16A1 Antibody - BSA Free
Western Blot MCT1/SLC16A1 Antibody - BSA Free
(15 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MTR Antibody
NB100-791
Western Blot MTR Antibody
Immunohistochemistry-Paraffin MTR Antibody
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
MCTS1 Antibody
(OTI2F9)
NBP2-03626
Western Blot MCTS1 Antibody (OTI2F9)
Immunohistochemistry-Paraffin MCTS1 Antibody (OTI2F9)
Immunohistochemistry-Paraffin MCTS1 Antibody (OTI2F9)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MLK2 Antibody
AF5066
Western Blot MLK2 Antibody
(2 Publications)
Species: Hu
Applications: WB
MPST Antibody
NBP1-82617
Western Blot MPST Antibody
Immunohistochemistry-Paraffin MPST Antibody
Immunocytochemistry/ Immunofluorescence MPST Antibody
(13 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MSTO1 Antibody
NBP2-33860
Western Blot MSTO1 Antibody
Western Blot MSTO1 Antibody
Immunohistochemistry-Paraffin MSTO1 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SLC16A4 Antibody
NBP2-13315
Immunohistochemistry-Paraffin SLC16A4 Antibody
Immunohistochemistry-Paraffin SLC16A4 Antibody
Immunohistochemistry-Paraffin SLC16A4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MCAT Recombinant
Protein Antigen
NBP1-83936PEP
MCAT Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MCAT Protein (NBP1-83936PEP) (0)

There are no publications for MCAT Protein (NBP1-83936PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCAT Protein (NBP1-83936PEP) (0)

There are no reviews for MCAT Protein (NBP1-83936PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCAT Protein (NBP1-83936PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCAT Products

Blogs on MCAT

There are no specific blogs for MCAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MCAT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MCAT