![Immunocytochemistry/Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Metallothionein-2A-Antibody-6G2-Immunocytochemistry-Immunofluorescence-H00004502-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 6G2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MT2A (NP_005944.1, 1 a.a. ~ 61 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
| Isotype | IgG2a Lambda |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MT2A |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | It has been used for ELISA and WB. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Metallothionein-2A-Antibody-6G2-ELISA-H00004502-M01-img0003.jpg "ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
