MAMLD1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human MAMLD1. Peptide sequence: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAMLD1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
1 mg/ml |
Purity |
Protein A purified |
Alternate Names for MAMLD1 Antibody
Background
MAMLD1, or Mastermind-like domain-containing protein 1, contains a 83 kDa, 106 kDa, and 80 kDa isoform, and is involved in transcription and acts as a co-activator for the HES3 promoter. Current research is being conducted on MAMLD1 and its relation to x-linked hypospadias type 2, myopathy, and spermatic cord torsion. The protein has no known interactions with any other proteins, but it is linked to the Notch-HLH transcription pathway, regulation of DNA-dependent transcription, and male gonad development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for MAMLD1 Antibody (NBP2-83177) (0)
There are no publications for MAMLD1 Antibody (NBP2-83177).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAMLD1 Antibody (NBP2-83177) (0)
There are no reviews for MAMLD1 Antibody (NBP2-83177).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAMLD1 Antibody (NBP2-83177) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAMLD1 Products
Blogs on MAMLD1