Home » MAD4 » MAD4 Antibodies » MAD4 Antibody - Azide and BSA Free

MAD4 Antibody - Azide and BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MAD4 Antibody [NBP3-03224] - Analysis of extracts of mouse lung, using MAD4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Western Blot: MAD4 Antibody [NBP3-03224] - Analysis of extracts of mouse lung, using MAD4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
Azide and BSA Free
NBP3-03224-20ul
Novus Biologicals offers 100% Guarantee

MAD4 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 110-209 of human MAD4 (NP_006445.1). RRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MXD4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for MAD4 Antibody - Azide and BSA Free

  • BHLHC12
  • bHLHc12Max-interacting transcriptional repressor MAD4
  • Class C basic helix-loop-helix protein 12
  • Mad4 homolog
  • MAD4Max-associated protein 4
  • MAX dimerization protein 4
  • Max dimerizer 4
  • MST149
  • MSTP149
  • MXD4 MAX dimerization protein 4

Background

MAD4 is a member of the MAD gene family . The MAD genes encode basic helix loop helix leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(48 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Mad Antibody
NBP2-85249
Western Blot Mad Antibody
Western Blot Mad Antibody
Western Blot Mad Antibody
Species: Hu, Mu
Applications: WB
Max Antibody
NB100-793
Immunohistochemistry-Paraffin Max Antibody
Immunofluorescence Max Antibody
Immunofluorescence Max Antibody
(3 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAD1L1/MAD1
Antibody - BSA Free
NBP1-32775
Immunohistochemistry-Paraffin MAD1L1/MAD1 Antibody - BSA Free
Western Blot MAD1L1/MAD1 Antibody - BSA Free
Western Blot MAD1L1/MAD1 Antibody - BSA Free
(2 Publications)
Species: Hu, Mar, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
AMPD1 Antibody -
BSA Free
NBP2-24509
Western Blot AMPD1 Antibody - BSA Free
Immunohistochemistry-Paraffin AMPD1 Antibody - BSA Free
(3 Publications)
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Mxi1 Antibody
[Unconjugated]
AF4185
Immunocytochemistry Mxi1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC
Smad3 Antibody -
BSA Free
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody - BSA Free
Western Blot Smad3 Antibody - BSA Free
Immunohistochemistry-Paraffin Smad3 Antibody - BSA Free
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
IkB-alpha Antibody
(6A920) - BSA Free
NB100-56507
Western Blot IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
MAD3 Antibody
(S07-6H7)
NBP3-19989
Western Blot MAD3 Antibody (S07-6H7)
Species: Hu, Mu, Rt
Applications: WB
MAX binding
protein Antibody (HL2 ...
NBP3-25567
Western Blot MAX binding protein Antibody (HL2309) - Azide and BSA Free
Western Blot MAX binding protein Antibody (HL2309) - Azide and BSA Free
Immunohistochemistry-Paraffin MAX binding protein Antibody (HL2309) - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MLX Antibody
[Unconjugated]
AF4186
Western Blot MLX Antibody [Unconjugated]
Immunocytochemistry MLX Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
Miz-1/ZBTB17
Antibody
AF3760
Western Blot Miz-1/ZBTB17 Antibody
(2 Publications)
Species: Hu
Applications: WB
Smad4 Antibody
[Unconjugated]
AF2097
Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]
Western Blot Smad4 Antibody [Unconjugated]
Immunocytochemistry Smad4 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ChIP, ICC, WB
n-Myc Antibody
(NMYC-1) - BSA Free
NB200-109
Western Blot n-Myc Antibody (NMYC-1) - BSA Free
Western Blot n-Myc Antibody (NMYC-1) - BSA Free
Immunocytochemistry/ Immunofluorescence n-Myc Antibody (NMYC-1) - BSA Free
(6 Publications)
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
OX40/TNFRSF4
Antibody [Unconjugate
AF3388
Immunohistochemistry OX40/TNFRSF4 Antibody [Unconjugated]
Neutralization OX40/TNFRSF4 Antibody [Unconjugated]
Flow Cytometry OX40/TNFRSF4 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Immunohistochemistry-Paraffin Ornithine Decarboxylase Antibody (ODC1/485)
Immunocytochemistry/ Immunofluorescence Ornithine Decarboxylase Antibody (ODC1/485)
Western Blot Ornithine Decarboxylase Antibody (ODC1/485)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
BLIMP1/PRDM1
Antibody (3H2-E8) - B ...
NB600-235
Immunocytochemistry/ Immunofluorescence BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
Flow Cytometry BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
Immunocytochemistry/ Immunofluorescence BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
(2 Reviews)
(52 Publications)
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CHREBP Antibody -
BSA Free
NB400-135
Western Blot CHREBP Antibody - BSA Free
Immunohistochemistry CHREBP Antibody - BSA Free
Western Blot CHREBP Antibody - BSA Free
(7 Reviews)
(158 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PAGE, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAD4 Antibody -
Azide and BSA Free
NBP3-03224
MAD4 Antibody - Azide and BSA Free
Species: Mu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for MAD4 Antibody (NBP3-03224) (0)

There are no publications for MAD4 Antibody (NBP3-03224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD4 Antibody (NBP3-03224) (0)

There are no reviews for MAD4 Antibody (NBP3-03224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAD4 Antibody (NBP3-03224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAD4 Products

Array NBP3-03224

Research Areas for MAD4 Antibody (NBP3-03224)

Find related products by research area.

Blogs on MAD4

There are no specific blogs for MAD4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAD4 Antibody - Azide and BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol MXD4