Home » Lysosomal Pro-X Carboxypeptidase/PRCP » Lysosomal Pro-X Carboxypeptidase/PRCP Proteins » Lysosomal Pro-X Carboxypeptidase/PRCP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Lysosomal Pro-X Carboxypeptidase/PRCP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Lysosomal Pro-X Carboxypeptidase/PRCP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRCP.

Source: E. coli

Amino Acid Sequence: KHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRCP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lysosomal Pro-X Carboxypeptidase/PRCP Recombinant Protein Antigen

  • Angiotensinase C
  • EC 3.4.16.2
  • HUMPCP
  • Lysosomal carboxypeptidase C
  • lysosomal Pro-X carboxypeptidase
  • PCPMGC2202
  • PRCP
  • Proline carboxypeptidase
  • prolylcarboxypeptidase (angiotensinase C)
  • prolylcarboxypeptidase isoform 1 preproprotein
  • Prolylcarboxypeptidase

Background

PRCP is encoded by this gene is a lysosomal prolylcarboxypeptidase, which cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Vang-like Protein
2/VANGL2 Antibody
AF4815
Western Blot Vang-like Protein 2/VANGL2 Antibody
Immunohistochemistry Vang-like Protein 2/VANGL2 Antibody
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
SPINK1 Antibody
(4D4)
H00006690-M01
Western Blot SPINK1 Antibody (4D4)
Immunohistochemistry SPINK1 Antibody (4D4)
Immunohistochemistry SPINK1 Antibody (4D4)
(1 Review)
(32 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
BMP-1/PCP Antibody
[Unconjugated]
AF1927
Western Blot BMP-1/PCP Antibody [Unconjugated]
Western Blot BMP-1/PCP Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: IP, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ADAR Antibody
(CL0176)
NBP3-05500
Immunocytochemistry/ Immunofluorescence ADAR Antibody (CL0176)
Immunohistochemistry-Paraffin ADAR Antibody (CL0176)
Immunohistochemistry-Paraffin ADAR Antibody (CL0176)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Dishevelled-1
Antibody
NBP2-24648
Western Blot Dishevelled-1 Antibody
Species: Hu, Mu, Pm, Rt
Applications: WB
Wnt-5a
[Unconjugated]
645-WN
Bioactivity Wnt-5a [Unconjugated]
(180 Publications)
Species: Hu, Mu
Applications: BA
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Wnt-11
[Unconjugated]
6179-WN
Wnt-11 [Unconjugated]
(20 Publications)
Species: Hu
Applications: BA
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
DHPS Antibody
NBP1-82648
Immunocytochemistry/ Immunofluorescence DHPS Antibody
Western Blot DHPS Antibody
Immunohistochemistry-Paraffin DHPS Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP) (0)

There are no publications for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP) (0)

There are no reviews for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lysosomal Pro-X Carboxypeptidase/PRCP Products

Research Areas for Lysosomal Pro-X Carboxypeptidase/PRCP Protein (NBP1-81644PEP)

Find related products by research area.

Blogs on Lysosomal Pro-X Carboxypeptidase/PRCP

There are no specific blogs for Lysosomal Pro-X Carboxypeptidase/PRCP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lysosomal Pro-X Carboxypeptidase/PRCP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRCP