![Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Analysis in human placenta and tonsil tissues. Corresponding GAA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LYAG-GAA-Antibody-Immunohistochemistry-Paraffin-NBP2-38142-img0008.jpg "Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Analysis in human placenta and tonsil tissues. Corresponding GAA RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTA |
| Predicted Species | Mouse (91%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GAA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LYAG/GAA Antibody (NBP2-38142)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: LYAG/GAA Antibody [NBP2-38142] - Analysis in control (vector only transfected HEK293T lysate) and GAA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/LYAG-GAA-Antibody-Western-Blot-NBP2-38142-img0007.jpg "Western Blot: LYAG/GAA Antibody [NBP2-38142] - Analysis in control (vector only transfected HEK293T lysate) and GAA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human prostate shows moderate positivity in lysosomes in glandular cells.](http://images.novusbio.com/fullsize/LYAG-GAA-Antibody-Immunohistochemistry-Paraffin-NBP2-38142-img0013.jpg "Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human prostate shows moderate positivity in lysosomes in glandular cells.")
![Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human pancreas shows weak to moderate positivity in lysosomes in exocrine glandular cells.](http://images.novusbio.com/fullsize/LYAG-GAA-Antibody-Immunohistochemistry-Paraffin-NBP2-38142-img0009.jpg "Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human pancreas shows weak to moderate positivity in lysosomes in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human placenta shows weak to moderate positivity in lysosomes in trophoblastic cells.](http://images.novusbio.com/fullsize/LYAG-GAA-Antibody-Immunohistochemistry-Paraffin-NBP2-38142-img0011.jpg "Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human placenta shows weak to moderate positivity in lysosomes in trophoblastic cells.")
![Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human tonsil shows no positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/LYAG-GAA-Antibody-Immunohistochemistry-Paraffin-NBP2-38142-img0012.jpg "Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human tonsil shows no positivity in non-germinal center cells.")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Western_Blot_12490.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Flow_Cytometry_12540.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/mab7616_human-integrin-alpha-2b-cd41-mab-clone-2530a-flow-cytometry-2462022151722.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")