![Western Blot: Ly-6E Antibody [NBP3-03570] - Analysis of extracts of various cell lines, using Ly-6E antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.](http://images.novusbio.com/fullsize/Ly-6E-Antibody-Western-Blot-NBP3-03570-img0002.jpg "Western Blot: Ly-6E Antibody [NBP3-03570] - Analysis of extracts of various cell lines, using Ly-6E antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human Ly-6E (NP_002337.1). LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LY6E |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Gail Seigel |
IHC-P | Mouse | 10/01/2022 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Ly-6E Antibody (NBP3-03570)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LY6E |
![Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP3-03570] - Analysis of L929 cells using LY6E Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining. Ly-6E antibody](http://images.novusbio.com/fullsize/Ly-6E-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03570-img0001.jpg "Immunocytochemistry/Immunofluorescence: Ly-6E Antibody [NBP3-03570] - Analysis of L929 cells using LY6E Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining. Ly-6E antibody")
![Immunohistochemistry-Paraffin: Ly-6E Antibody [NBP3-03570] - Left panel shows negative control antibody on mouse kidney; right panel shows Ly-6E antibody at 1:100 dilution on mouse kidney. Brown = DAB reaction. Mouse kidneys were deparaffinized through xylenes and alcohols, boiled in citrate buffer for 25 minutes, then PBS-Tween at room temp for 5 minutes, followed by Scytek CRF anti-polyvalent polymer DAB kit protocol. Slides were counterstained for 30 seconds in hematoxylin and coverslipped. Image from verified customer review.](http://images.novusbio.com/fullsize/Ly-6E-Antibody-Immunohistochemistry-Paraffin-NBP3-03570-img0003.jpg "Immunohistochemistry-Paraffin: Ly-6E Antibody [NBP3-03570] - Left panel shows negative control antibody on mouse kidney; right panel shows Ly-6E antibody at 1:100 dilution on mouse kidney. Brown = DAB reaction. Mouse kidneys were deparaffinized through xylenes and alcohols, boiled in citrate buffer for 25 minutes, then PBS-Tween at room temp for 5 minutes, followed by Scytek CRF anti-polyvalent polymer DAB kit protocol. Slides were counterstained for 30 seconds in hematoxylin and coverslipped. Image from verified customer review.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")