Home » Lumican » Lumican Proteins » Lumican Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Lumican Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Lumican Protein (NBP1-87726PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Lumican Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LUM.

Source: E. coli

Amino Acid Sequence: DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LUM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lumican Recombinant Protein Antigen

  • KSPG lumican
  • LDC
  • LUM
  • lumican proteoglycan
  • Lumican
  • SLRR2D
  • SLRR2DLDCKeratan sulfate proteoglycan lumican

Background

Lumican encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Fibromodulin/FMOD
Antibody
AF5945
Western Blot Fibromodulin/FMOD Antibody
Species: Hu, Mu, Rt
Applications: WB
KERA Antibody
NBP1-84425
Immunohistochemistry-Paraffin KERA Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P
Biglycan Antibody
AF2667
Immunohistochemistry Biglycan Antibody
Immunocytochemistry/ Immunofluorescence Biglycan Antibody
(17 Publications)
Species: Hu
Applications: IHC, WB
Mimecan/OIF
Antibody
AF2949
Mimecan/OIF Antibody
(4 Publications)
Species: Mu
Applications: WB
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DSPG3/EPYC Antibody
NBP1-70338
Western Blot DSPG3/EPYC Antibody
Immunohistochemistry-Paraffin DSPG3/EPYC Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Endostatin [HRP]
DNST0
N/A Endostatin [HRP]
N/A Endostatin [HRP]
(22 Publications)
Species: Hu
Applications: ELISA
OXSM Antibody
NBP1-84732
Western Blot OXSM Antibody
Immunohistochemistry-Paraffin OXSM Antibody
Immunohistochemistry-Paraffin OXSM Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Immunocytochemistry/ Immunofluorescence N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
PRELP Antibody
[Unconjugated]
AF6447
Western Blot PRELP Antibody [Unconjugated]
Immunocytochemistry PRELP Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(552 Publications)
Species: Hu
Applications: BA
Ornithine
Decarboxylase Antibod ...
NBP2-32887
Immunohistochemistry-Paraffin Ornithine Decarboxylase Antibody (ODC1/485)
Immunocytochemistry/ Immunofluorescence Ornithine Decarboxylase Antibody (ODC1/485)
Western Blot Ornithine Decarboxylase Antibody (ODC1/485)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Lumican
Recombinant Protein A
NBP1-87726PEP
Lumican Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Lumican Protein (NBP1-87726PEP) (0)

There are no publications for Lumican Protein (NBP1-87726PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lumican Protein (NBP1-87726PEP) (0)

There are no reviews for Lumican Protein (NBP1-87726PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lumican Protein (NBP1-87726PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lumican Products

Research Areas for Lumican Protein (NBP1-87726PEP)

Find related products by research area.

Blogs on Lumican

There are no specific blogs for Lumican, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lumican Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LUM