![Western Blot: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody (M03), clone 6F7. Lane 1: LETM1 transfected lysatE (83.4 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LETM1-Antibody-6F7-Western-Blot-H00003954-M03-img0009.jpg "Western Blot: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody (M03), clone 6F7. Lane 1: LETM1 transfected lysatE (83.4 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, Func, ICC/IF, IHC, IP |
| Clone | 6F7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | LETM1 (NP_036450, 601 a.a. ~ 708 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA |
| Specificity | LETM1 - leucine zipper-EF-hand containing transmembrane protein 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | LETM1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of monoclonal antibody to LETM1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/LETM1-Antibody-6F7-Immunocytochemistry-Immunofluorescence-H00003954-M03-img0005.jpg "Immunocytochemistry/Immunofluorescence: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of monoclonal antibody to LETM1 on HeLa cell. Antibody concentration 10 ug/ml")
![Immunohistochemistry-Paraffin: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/LETM1-Antibody-6F7-Immunohistochemistry-Paraffin-H00003954-M03-img0006.jpg "Immunohistochemistry-Paraffin: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml")
![Western Blot: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize/LETM1-Antibody-6F7-Western-Blot-H00003954-M03-img0008.jpg "Western Blot: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 expression in HeLa (Cat # L013V1).")
![ELISA: LETM1 Antibody (6F7) [H00003954-M03] - Detection limit for recombinant GST tagged LETM1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/LETM1-Antibody-6F7-ELISA-H00003954-M03-img0004.jpg "ELISA: LETM1 Antibody (6F7) [H00003954-M03] - Detection limit for recombinant GST tagged LETM1 is approximately 0.03ng/ml as a capture antibody.")
![Immunoprecipitation: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 transfected lysate using anti-LETM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LETM1 rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/LETM1-Antibody-6F7-Immunoprecipitation-H00003954-M03-img0007.jpg "Immunoprecipitation: LETM1 Antibody (6F7) [H00003954-M03] - Analysis of LETM1 transfected lysate using anti-LETM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LETM1 rabbit polyclonal antibody.")
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot TACC3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TACC3_AF5720_Western_Blot_5818.jpg)
![Simple Western TACC3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TACC3_AF5720_Simple_Western_17066.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")