Kir2.2 Antibody

Images

 
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: Kir2.2 Antibody [NBP2-87693] - Rabbit Anti-KCNJ12 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary ...read more
Western Blot: Kir2.2 Antibody [NBP2-87693] - WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Pancreas. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Stomach. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Kir2.2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Kir2.2. Peptide sequence: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Kir2.2 Antibody

  • ATP-sensitive inward rectifier potassium channel 12
  • hIRK
  • hIRK1
  • hkir2.2x
  • Inward rectifier K(+) channel Kir2.2
  • Inward rectifier K(+) channel Kir2.2v
  • inward rectifier K(+) channel Kir2.6
  • IRK2
  • IRK-2
  • IRK2IRK-2
  • KCNJ12
  • kcnj12x
  • KCNJN1
  • KCNJN1FLJ14167
  • Kir2.2
  • Kir2.2v
  • Potassium channel, inwardly rectifying subfamily J member 12
  • potassium inwardly-rectifying channel, subfamily J, inhibitor 1
  • potassium inwardly-rectifying channel, subfamily J, member 12

Background

FUNCTION: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Tissue specificity: Highest level in cerebellum. Moderately found in kidney, forebrain and skeletal muscle. Not detected in uterus, liver and pancreas. Subcellular location: Membrane, Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-57775
Species: Hu
Applications: ICC/IF, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88081
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Kir2.2 Antibody (NBP2-87693) (0)

There are no publications for Kir2.2 Antibody (NBP2-87693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kir2.2 Antibody (NBP2-87693) (0)

There are no reviews for Kir2.2 Antibody (NBP2-87693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kir2.2 Antibody (NBP2-87693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kir2.2 Products

Research Areas for Kir2.2 Antibody (NBP2-87693)

Find related products by research area.

Blogs on Kir2.2

There are no specific blogs for Kir2.2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kir2.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ12