![Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding KIF21A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/KIF21A-Antibody-Immunohistochemistry-Paraffin-NBP2-37969-img0006.jpg "Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding KIF21A RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIF21A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/16250.jpg)
![Immunocytochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/beta-III_Tubulin_MAB1195_Immunocytochemistry_6556.jpg)
![Immunohistochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/betaIII_Tubulin_MAB1195_Immunohistochemistry_22757.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for KIF21A Antibody (NBP2-37969)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: KIF21A Antibody [NBP2-37969] - Staining of human cell line SH-SY5Y shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/KIF21A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37969-img0002.jpg "Immunocytochemistry/Immunofluorescence: KIF21A Antibody [NBP2-37969] - Staining of human cell line SH-SY5Y shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human fallopian tube shows strong cytoplasmic and moderate luminal membranous positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/KIF21A-Antibody-Immunohistochemistry-Paraffin-NBP2-37969-img0009.jpg "Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human fallopian tube shows strong cytoplasmic and moderate luminal membranous positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/KIF21A-Antibody-Immunohistochemistry-Paraffin-NBP2-37969-img0007.jpg "Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/KIF21A-Antibody-Immunohistochemistry-Paraffin-NBP2-37969-img0008.jpg "Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human skeletal muscle shows weak positivity in myocytes.](http://images.novusbio.com/fullsize/KIF21A-Antibody-Immunohistochemistry-Paraffin-NBP2-37969-img0010.jpg "Immunohistochemistry-Paraffin: KIF21A Antibody [NBP2-37969] - Staining of human skeletal muscle shows weak positivity in myocytes.")
![Western Blot Plexin C1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_C1_AF5375_Western_Blot_5704.jpg)
![Immunohistochemistry Plexin C1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_C1_AF5375_Immunohistochemistry_11462.jpg)
![Flow Cytometry Plexin C1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_C1_AF5375_Flow_Cytometry_8271.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")