Home » Jagged 2 » Jagged 2 Proteins » Jagged 2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Jagged 2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Jagged 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Jagged 2.

Source: E. coli

Amino Acid Sequence: LTLHFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JAG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55301.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Jagged 2 Recombinant Protein Antigen

  • HJ2
  • JAG2
  • Jagged 2
  • Jagged2
  • protein jagged-2
  • SER2

Background

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Knockout Validated Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Notch-4 Antibody
[Unconjugated]
AF3847
Immunocytochemistry Notch-4 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(45 Publications)
Species: Hu
Applications: BA
Notch-2 Antibody
[Unconjugated]
AF3735
Immunohistochemistry Notch-2 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
Notch-3 Antibody
(1G5)
H00004854-M01
ELISA Notch-3 Antibody (1G5)
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cdk9 Antibody
(1C4E3)
NBP3-15345
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Immunohistochemistry-Paraffin Cdk9 Antibody (1C4E3)
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC, IHC-P, IP, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
DLL4 Antibody
[Unconjugated]
AF1389
Western Blot DLL4 Antibody [Unconjugated]
Immunocytochemistry DLL4 Antibody [Unconjugated]
Immunohistochemistry DLL4 Antibody [Unconjugated]
(1 Review)
(63 Publications)
Species: Mu
Applications: ICC, IHC, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
DLL1 Antibody
[Unconjugated]
AF3970
Immunohistochemistry DLL1 Antibody [Unconjugated]
Flow Cytometry DLL1 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence DLL1 Antibody [Unconjugated]
(6 Publications)
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Pref-1/DLK1/FA1
Antibody (211309)
MAB1144
Immunocytochemistry Pref-1/DLK1/FA1 Antibody (211309)
Flow Cytometry Pref-1/DLK1/FA1 Antibody (211309)
(1 Review)
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
HES5 Antibody -
BSA Free
NBP2-41305
Immunocytochemistry/ Immunofluorescence HES5 Antibody - BSA Free
Western Blot HES5 Antibody - BSA Free
Immunohistochemistry-Paraffin HES5 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ARS2 Antibody
NBP2-15473
Western Blot ARS2 Antibody
Immunohistochemistry-Paraffin ARS2 Antibody
Immunocytochemistry/ Immunofluorescence ARS2 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
GLI-1 Antibody -
BSA Free
NB600-600
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
Knockdown Validated GLI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin GLI-1 Antibody - BSA Free
(1 Review)
(55 Publications)
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
DLL3 Antibody
NBP2-24669
Western Blot DLL3 Antibody
Immunohistochemistry-Paraffin DLL3 Antibody
(4 Publications)
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(656 Publications)
Species: Mu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA

Publications for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP) (0)

There are no publications for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP) (0)

There are no reviews for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Jagged 2 Products

Research Areas for Jagged 2 Recombinant Protein Antigen (NBP2-55301PEP)

Find related products by research area.

Blogs on Jagged 2.

Check out the latest blog posts on Jagged 2.
Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge
We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Jagged 2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol JAG2