![Western Blot: Jagged 1 Antibody (1E12.) [H00000182-M01A] - Western Blot detection against Immunogen (35.64 KDa) .](http://images.novusbio.com/fullsize/Jagged-1-Antibody-1E12-Western-Blot-H00000182-M01A-img0001.jpg "Western Blot: Jagged 1 Antibody (1E12.) [H00000182-M01A] - Western Blot detection against Immunogen (35.64 KDa) .")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, IHC, KO |
| Clone | 1E12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | JAG1 (NP_000205, 531 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG |
| Specificity | JAG1 (1E12) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | JAG1 |
| Purity | Unpurified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. Use in Immunohistochemistry reported in scientific literature (PMID: 30708185). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | Ascites |
| Preservative | No Preservative |
| Purity | Unpurified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Knockout Validated: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged 1 regulates learning-dependent Notch induction and is enriched presynaptically. Fluorescent double-labeling shows the expression of Notch1 (red) following spatial exploration in CTLs and Jagged 1cKO. Jagged 1 labeling (green) is used to validate the absence of Jagged 1 in the Jagged 1cKO (Jag1cKOs). Image collected and cropped by CiteAb from the following publication (www.journal.frontiersin.org/article/10.3389/fncel.2017.00220/full) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Jagged-1-Antibody-1E12-Knockout-Validated-H00000182-M01A-img0002.jpg "Knockout Validated: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged 1 regulates learning-dependent Notch induction and is enriched presynaptically. Fluorescent double-labeling shows the expression of Notch1 (red) following spatial exploration in CTLs and Jagged 1cKO. Jagged 1 labeling (green) is used to validate the absence of Jagged 1 in the Jagged 1cKO (Jag1cKOs). Image collected and cropped by CiteAb from the following publication (www.journal.frontiersin.org/article/10.3389/fncel.2017.00220/full) licensed under a CC-BY license.")
![Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Targeted loss of Jagged1 in adult mouse neurons causes a spatial memory deficit. A schematic representation of the Jagged1 floxed allele used to generate the mice with TAM-inducible loss of Jagged1 gene (A). Representative immunofluorescence images of single confocal z-plane showing a near complete loss of Jagged1 protein (green) from hippocampal pyramidal neurons labeled by NeuN (red) of Jagged1cKO mice (B). Representative images from immunoblots showing the expression of Jagged1, DNER in Jagged1cKO mice & control mice (C). GAPDH is used as a loading control. Bar graph showing the quantitation of optical densities of Jagged1 & DNER bands in CTLs & Jagged1cKO mice (D). A graphic showing the behavioral arena for Y-maze spontaneous alternation test (E). Jagged1cKO mice show a significant deficit in hippocampus dependent working memory in the Y-maze spontaneous alternation test (F). A diagram showing the experimental arena for the hidden arm version of the Y-maze (G). Jagged1cKO mice show a significant reduction in the time spent in the hidden arm, suggesting a spatial memory defect (H). A schematic showing the experimental setup for the Novel Object Displacement test (I). Jagged1cKO mice exhibit a statistical significant reduction in discrimination index, a measure of spatial memory defect (J). Scale bar in (B) is 50 μm. Graphs are represented as mean ± SEM, *p < 0.05, **p < 0.01, & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00000182-m01a_mouse-monoclonal-jagged-1-antibody-1e12-310202415485115.jpg "Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Targeted loss of Jagged1 in adult mouse neurons causes a spatial memory deficit. A schematic representation of the Jagged1 floxed allele used to generate the mice with TAM-inducible loss of Jagged1 gene (A). Representative immunofluorescence images of single confocal z-plane showing a near complete loss of Jagged1 protein (green) from hippocampal pyramidal neurons labeled by NeuN (red) of Jagged1cKO mice (B). Representative images from immunoblots showing the expression of Jagged1, DNER in Jagged1cKO mice & control mice (C). GAPDH is used as a loading control. Bar graph showing the quantitation of optical densities of Jagged1 & DNER bands in CTLs & Jagged1cKO mice (D). A graphic showing the behavioral arena for Y-maze spontaneous alternation test (E). Jagged1cKO mice show a significant deficit in hippocampus dependent working memory in the Y-maze spontaneous alternation test (F). A diagram showing the experimental arena for the hidden arm version of the Y-maze (G). Jagged1cKO mice show a significant reduction in the time spent in the hidden arm, suggesting a spatial memory defect (H). A schematic showing the experimental setup for the Novel Object Displacement test (I). Jagged1cKO mice exhibit a statistical significant reduction in discrimination index, a measure of spatial memory defect (J). Scale bar in (B) is 50 μm. Graphs are represented as mean ± SEM, *p < 0.05, **p < 0.01, & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 regulates learning-dependent Notch induction & is enriched presynaptically. Fluorescent double-labeling shows the expression of Notch1 (red) following spatial exploration in CTLs & Jagged1cKO (A). Jagged1 labeling (green) is used to validate the absence of Jagged1 in the Jagged1cKO (Jag1cKOs) (A,C). Diagram summarizing the Notch1 fluorescence intensities distribution in randomly picked 69 & 71 CA1 neurons in CTLs & Jagged1cKOs, respectively (p < 0.001) (B). Double immunofluorescence of the Notch1 transcriptional target, Hes5, in CTLs & JaggedcKOs following spatial exploration (C). Diagram summarizing the Hes5 fluorescence intensity distribution in randomly picked 64 & 70 CA1 neurons in CTL & Jagged1cKO, respectively (p < 0.001) (D). Representatives gold Immuno-electron microscopy panels from three WT mice show that Jagged1 particles are localized in presynaptic terminals, bound to presynaptic vesicles (Pre) (E–E‴). Immunogold particles are also apparent at the Postsynaptic density (Post) (E,E″,E‴). Box Plot summarizing the particle counts in presynaptic & postsynaptic terminal areas drawn on Immunoelectromicroscopy micrograph for Jagged1 indicates that the presynapse is enriched with Jag1 particles as compared to the postsynaptic terminal (p < 0.001) (F). Scale bars are: 20 μm in (A), 10 μm in (C), 400 nm in (E–E‴). AU, arbitrary units; Pre, presynaptic; Post, postsynaptic; & Ax, axon. Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00000182-m01a_mouse-monoclonal-jagged-1-antibody-1e12-310202415483644.jpg "Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 regulates learning-dependent Notch induction & is enriched presynaptically. Fluorescent double-labeling shows the expression of Notch1 (red) following spatial exploration in CTLs & Jagged1cKO (A). Jagged1 labeling (green) is used to validate the absence of Jagged1 in the Jagged1cKO (Jag1cKOs) (A,C). Diagram summarizing the Notch1 fluorescence intensities distribution in randomly picked 69 & 71 CA1 neurons in CTLs & Jagged1cKOs, respectively (p < 0.001) (B). Double immunofluorescence of the Notch1 transcriptional target, Hes5, in CTLs & JaggedcKOs following spatial exploration (C). Diagram summarizing the Hes5 fluorescence intensity distribution in randomly picked 64 & 70 CA1 neurons in CTL & Jagged1cKO, respectively (p < 0.001) (D). Representatives gold Immuno-electron microscopy panels from three WT mice show that Jagged1 particles are localized in presynaptic terminals, bound to presynaptic vesicles (Pre) (E–E‴). Immunogold particles are also apparent at the Postsynaptic density (Post) (E,E″,E‴). Box Plot summarizing the particle counts in presynaptic & postsynaptic terminal areas drawn on Immunoelectromicroscopy micrograph for Jagged1 indicates that the presynapse is enriched with Jag1 particles as compared to the postsynaptic terminal (p < 0.001) (F). Scale bars are: 20 μm in (A), 10 μm in (C), 400 nm in (E–E‴). AU, arbitrary units; Pre, presynaptic; Post, postsynaptic; & Ax, axon. Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 expression in brains & CSF of AD patients. Representative double fluorescent immunolabelings for Jagged1 (green) & Notch1 (red) counterstained with Thioflavin-T or DAPI (blue) on postmortem brain sections comprising the hippocampal CA fields from healthy age-matched controls & AD patients (A–C). in healthy controls, Jagged1 is localized to somata of neurons where also Notch1 is expressed. As expected, Thioflavin-T labeling is negligible (A,A′). AD sections show fibrillary aggregates (B,B′) & (C,C′) core plaques double positive for Notch1 & Thioflavin-T. Jag1 expression is scattered in parenchyma & low in, degenerated neurons (white arrows) (B,B′). Jag1 overlays in small double positive aggregates for Notch1 & Thioflavin-T (100x magnification) in radiating plaques with a visible reduction in Jagged1 cellular expression (B–C′). Box plots summarizing the quantification of fluorescence intensities of Jagged1 immunolabeled neurons shows a significant reduction in Jagged1 expression in AD patients (p < 0.001). Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00000182-m01a_mouse-monoclonal-jagged-1-antibody-1e12-310202415485139.jpg "Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 expression in brains & CSF of AD patients. Representative double fluorescent immunolabelings for Jagged1 (green) & Notch1 (red) counterstained with Thioflavin-T or DAPI (blue) on postmortem brain sections comprising the hippocampal CA fields from healthy age-matched controls & AD patients (A–C). in healthy controls, Jagged1 is localized to somata of neurons where also Notch1 is expressed. As expected, Thioflavin-T labeling is negligible (A,A′). AD sections show fibrillary aggregates (B,B′) & (C,C′) core plaques double positive for Notch1 & Thioflavin-T. Jag1 expression is scattered in parenchyma & low in, degenerated neurons (white arrows) (B,B′). Jag1 overlays in small double positive aggregates for Notch1 & Thioflavin-T (100x magnification) in radiating plaques with a visible reduction in Jagged1 cellular expression (B–C′). Box plots summarizing the quantification of fluorescence intensities of Jagged1 immunolabeled neurons shows a significant reduction in Jagged1 expression in AD patients (p < 0.001). Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 expression in brains & CSF of AD patients. Representative double fluorescent immunolabelings for Jagged1 (green) & Notch1 (red) counterstained with Thioflavin-T or DAPI (blue) on postmortem brain sections comprising the hippocampal CA fields from healthy age-matched controls & AD patients (A–C). in healthy controls, Jagged1 is localized to somata of neurons where also Notch1 is expressed. As expected, Thioflavin-T labeling is negligible (A,A′). AD sections show fibrillary aggregates (B,B′) & (C,C′) core plaques double positive for Notch1 & Thioflavin-T. Jag1 expression is scattered in parenchyma & low in, degenerated neurons (white arrows) (B,B′). Jag1 overlays in small double positive aggregates for Notch1 & Thioflavin-T (100x magnification) in radiating plaques with a visible reduction in Jagged1 cellular expression (B–C′). Box plots summarizing the quantification of fluorescence intensities of Jagged1 immunolabeled neurons shows a significant reduction in Jagged1 expression in AD patients (p < 0.001). Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00000182-m01a_mouse-monoclonal-jagged-1-antibody-1e12-310202415482294.jpg "Immunocytochemistry/ Immunofluorescence: Jagged 1 Antibody (1E12) [H00000182-M01A] - Jagged1 expression in brains & CSF of AD patients. Representative double fluorescent immunolabelings for Jagged1 (green) & Notch1 (red) counterstained with Thioflavin-T or DAPI (blue) on postmortem brain sections comprising the hippocampal CA fields from healthy age-matched controls & AD patients (A–C). in healthy controls, Jagged1 is localized to somata of neurons where also Notch1 is expressed. As expected, Thioflavin-T labeling is negligible (A,A′). AD sections show fibrillary aggregates (B,B′) & (C,C′) core plaques double positive for Notch1 & Thioflavin-T. Jag1 expression is scattered in parenchyma & low in, degenerated neurons (white arrows) (B,B′). Jag1 overlays in small double positive aggregates for Notch1 & Thioflavin-T (100x magnification) in radiating plaques with a visible reduction in Jagged1 cellular expression (B–C′). Box plots summarizing the quantification of fluorescence intensities of Jagged1 immunolabeled neurons shows a significant reduction in Jagged1 expression in AD patients (p < 0.001). Image collected & cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fncel.2017.00220/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")