![Western Blot: JAB1 Antibody (3X5F0) [NBP3-16328] - Western blot analysis of extracts of various cell lines, using JAB1 Rabbit mAb (NBP3-16328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/JAB1-Antibody-3X5F0-Western-Blot-NBP3-16328-img0006.jpg "Western Blot: JAB1 Antibody (3X5F0) [NBP3-16328] - Western blot analysis of extracts of various cell lines, using JAB1 Rabbit mAb (NBP3-16328) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, ChIP |
| Clone | 3X5F0 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1 (Q92905). MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | COPS5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for JAB1 Antibody (NBP3-16328)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COPS5 |
![Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunofluorescence analysis of U-2 OS cells using JAB1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-52202511374142.jpg "Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunofluorescence analysis of U-2 OS cells using JAB1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunofluorescence analysis of NIH-3T3 cells using JAB1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-522025125424.jpg "Immunocytochemistry/ Immunofluorescence: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunofluorescence analysis of NIH-3T3 cells using JAB1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Chromatin Immunoprecipitation: JAB1 Antibody (3X5F0) [NBP3-16328] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-52202511374125.jpg "Chromatin Immunoprecipitation: JAB1 Antibody (3X5F0) [NBP3-16328] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-5220251215433.jpg "Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-52202511383715.jpg "Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-52202511361242.jpg "Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-5220251242563.jpg "Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-522025125413.jpg "Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16328_rabbit-jab1-mab-3x5f0-5220251255570.jpg "Immunohistochemistry: JAB1 Antibody (3X5F0) [NBP3-16328] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using JAB1 Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)
![Western Blot MIF Antibody (12302) [Unconjugated]](https://images.novusbio.com/images2/MIF_MAB289_Western_Blot_16701.jpg)
![Simple Western MIF Antibody (12302) [Unconjugated]](https://images.novusbio.com/images2/MIF_MAB289_Simple_Western_18975.jpg)
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")