Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRS1. Source: E. coli Amino Acid Sequence: RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | IRS1 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68666. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for IRS1 Recombinant Protein Antigen (NBP2-68666PEP)Find related products by research area.
|
Insulin signaling in adipocytes: Carbohydrate-signaling transcription factor ChREBP is the link between lipolytic enzyme Hormone-Sensitive Lipase and lipogenic enzyme ELOVL6 By Jamshed Arslan, Pharm. D., PhD. Insulin resistance in adipocytes is a major feature of metabolic syndrome . Disrupted adipose tissue metabolism can lead to accumulation of lipid intermediates in insul... Read full blog post. |
Signalling Advances in Adiponectin Antibody Research Adiponectin is an adipocytokine protein that positively regulates metabolism of lipids and glucose by suppressing glucose production from the liver, stimulating insulin sensitivity, and increasing the rate of fatty acid oxidation and glucose uptake. I... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | IRS1 |