Home » IRF8 » IRF8 Proteins » Recombinant Human IRF8 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human IRF8 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human IRF8 GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-426 of Human IRF8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
IRF8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
74.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRF8 GST (N-Term) Protein

  • ICSBP1
  • ICSBPH-ICSBP
  • interferon consensus sequence binding protein 1
  • Interferon consensus sequence-binding protein
  • interferon regulatory factor 8
  • IRF8
  • IRF-8ICSBP1

Background

Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRF1 Antibody
[Unconjugated]
AF4715
Western Blot IRF1 Antibody [Unconjugated]
Western Blot IRF1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
MuRF1/TRIM63
Antibody [Unconjugate
AF5366
Western Blot MuRF1/TRIM63 Antibody [Unconjugated]
Simple Western MuRF1/TRIM63 Antibody [Unconjugated]
Western Blot MuRF1/TRIM63 Antibody [Unconjugated]
(26 Publications)
Species: Hu, Mu, Rt
Applications: Simple Western, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot PU.1/Spi-1 Antibody
Western Blot PU.1/Spi-1 Antibody
Flow Cytometry PU.1/Spi-1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(453 Publications)
Species: Hu
Applications: BA
IRF2 Antibody (3B5)
H00003660-M02
Western Blot IRF2 Antibody (3B5)
Immunocytochemistry/ Immunofluorescence IRF2 Antibody (3B5)
Immunohistochemistry-Paraffin IRF2 Antibody (3B5)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
IRF4 Antibody
AF5525
Immunohistochemistry IRF4 Antibody
Western Blot IRF4 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
IRF9 Antibody
NBP2-16991
Western Blot IRF9 Antibody
Immunohistochemistry-Paraffin IRF9 Antibody
Western Blot IRF9 Antibody
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(155 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
NRAMP1/SLC11A1
Antibody (910825)
MAB8400
Western Blot NRAMP1/SLC11A1 Antibody (910825)
Flow Cytometry NRAMP1/SLC11A1 Antibody (910825)
Species: Hu
Applications: CyTOF-ready, Flow, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(141 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB

Publications for IRF8 Recombinant Protein (H00003394-P01) (0)

There are no publications for IRF8 Recombinant Protein (H00003394-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF8 Recombinant Protein (H00003394-P01) (0)

There are no reviews for IRF8 Recombinant Protein (H00003394-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF8 Recombinant Protein (H00003394-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRF8 Products

Blogs on IRF8

There are no specific blogs for IRF8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRF8 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol IRF8