![Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human eye, retina, kidney, liver and pancreas using Anti-IMPG2 antibody NBP2-54954 (A) shows similar protein distribution across tissues to independent antibody NBP2-58919 (B).](http://images.novusbio.com/fullsize/IMPG2-Antibody-Immunohistochemistry-Paraffin-NBP2-54954-img0004.jpg "Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human eye, retina, kidney, liver and pancreas using Anti-IMPG2 antibody NBP2-54954 (A) shows similar protein distribution across tissues to independent antibody NBP2-58919 (B).")
| Reactivity | Hu, PmSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IMPG2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended.. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
| Publication using NBP2-54954 | Applications | Species |
|---|---|---|
| Yamasaki S, Tu H, Matsuyama T et al. A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation iScience 2022-01-01 [PMID: 35024589] (IHC-Fr, Monkey) | IHC-Fr | Monkey |
Secondary Antibodies |
Isotype Controls |
Research Areas for IMPG2 Antibody (NBP2-54954)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IMPG2 |
![Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/IMPG2-Antibody-Immunohistochemistry-Paraffin-NBP2-54954-img0007.jpg "Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human eye retina shows strong cytoplasmic positivity in rodes and cones cells.](http://images.novusbio.com/fullsize/IMPG2-Antibody-Immunohistochemistry-Paraffin-NBP2-54954-img0003.jpg "Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human eye retina shows strong cytoplasmic positivity in rodes and cones cells.")
![Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/IMPG2-Antibody-Immunohistochemistry-Paraffin-NBP2-54954-img0005.jpg "Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/IMPG2-Antibody-Immunohistochemistry-Paraffin-NBP2-54954-img0006.jpg "Immunohistochemistry-Paraffin: IMPG2 Antibody [NBP2-54954] - Staining of human liver shows no positivity in hepatocytes as expected.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Western_Blot_5199.jpg)
![Immunocytochemistry GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA-3_AF2605_Immunocytochemistry_6486.jpg)
![Simple Western GATA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/GATA3_AF2605_Simple_Western_16988.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")