![Immunocytochemistry/Immunofluorescence: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/IFN-alpha-beta-R1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83119-img0004.jpg "Immunocytochemistry/Immunofluorescence: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFNAR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Bioactivity C1QL1 [Unconjugated]](https://images.novusbio.com/images2/C1qL1_9134TN_1238.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
| Publication using NBP1-83119 | Applications | Species |
|---|---|---|
| Li H, Wang X, Wang Y et al. Secreted LRPAP1 binds and triggers IFNAR1 degradation to facilitate virus evasion from cellular innate immunity Signal Transduct Target Ther 2023-09-25 [PMID: 37743411] |
Secondary Antibodies |
Isotype Controls |
Research Areas for IFN-alpha/beta R1 Antibody (NBP1-83119)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFNAR1 |
![Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/IFN-alpha-beta-R1-Antibody-Immunohistochemistry-Paraffin-NBP1-83119-img0010.jpg "Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human kidney shows strong positivity in extracellular matrix in cells in tubules.](http://images.novusbio.com/fullsize/IFN-alpha-beta-R1-Antibody-Immunohistochemistry-Paraffin-NBP1-83119-img0007.jpg "Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human kidney shows strong positivity in extracellular matrix in cells in tubules.")
![Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human placenta shows strong positivity in extracellular matrix in trophoblastic cells.](http://images.novusbio.com/fullsize/IFN-alpha-beta-R1-Antibody-Immunohistochemistry-Paraffin-NBP1-83119-img0008.jpg "Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human placenta shows strong positivity in extracellular matrix in trophoblastic cells.")
![Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human skeletal muscle shows no positivity in monocytes as expected.](http://images.novusbio.com/fullsize/IFN-alpha-beta-R1-Antibody-Immunohistochemistry-Paraffin-NBP1-83119-img0009.jpg "Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human skeletal muscle shows no positivity in monocytes as expected.")
![Enzyme Activity Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-enzyme-activity-202202316147.jpg)
![SDS-PAGE Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-sds-page-2022023162028.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")