Home » HSPB8/HSP22 » HSPB8/HSP22 Proteins » HSPB8/HSP22 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HSPB8/HSP22 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HSPB8/HSP22 Protein (NBP1-84945PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HSPB8/HSP22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPB8.

Source: E. coli

Amino Acid Sequence: LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPB8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84945.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSPB8/HSP22 Recombinant Protein Antigen

  • Alpha-crystallin C chain
  • CMT2L
  • CRYAC
  • DHMN2
  • E2IG1
  • E2IG1E2-induced gene 1 protein
  • H11
  • H11DHMN2
  • heat shock 22kDa protein 8
  • heat shock 27kDa protein 8
  • heat shock protein beta-8
  • HMN2
  • HMN2A
  • HSP22
  • HSP22CMT2L
  • HSPB8
  • Protein kinase H11
  • Small stress protein-like protein HSP22

Background

HSP22 is encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HSP27 Antibody
(G3.1)
NBP2-32972
Flow Cytometry HSP27 Antibody (G3.1)
Western Blot HSP27 Antibody (G3.1)
Immunocytochemistry/ Immunofluorescence HSP27 Antibody (G3.1)
(1 Review)
(5 Publications)
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HSP20/HSPB6
Antibody (494310) [Un ...
MAB4200
Western Blot HSP20/HSPB6 Antibody (494310) [Unconjugated]
Simple Western HSP20/HSPB6 Antibody (494310) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
AlphaB
Crystallin/CRYAB Anti ...
NBP1-47708
Western Blot AlphaB Crystallin/CRYAB Antibody (OTI6A9)
Flow Cytometry AlphaB Crystallin/CRYAB Antibody (OTI6A9)
Immunocytochemistry/ Immunofluorescence AlphaB Crystallin/CRYAB Antibody (OTI6A9)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
HspA4 Antibody
NBP1-81696
Western Blot HspA4 Antibody
Immunohistochemistry-Paraffin HspA4 Antibody
Western Blot HspA4 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Histamine H4R
Antibody - BSA Free
NLS3775
Immunohistochemistry-Paraffin Histamine H4R Antibody - BSA Free
Immunohistochemistry-Paraffin Histamine H4R Antibody - BSA Free
Immunohistochemistry-Paraffin Histamine H4R Antibody - BSA Free
(2 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA H4/n Antibody (3E7H2) - BSA Free
Western Blot H4/n Antibody (3E7H2) - BSA Free
Flow Cytometry H4/n Antibody (3E7H2) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKAP5 Antibody -
BSA Free
NBP2-92794
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Western Blot AKAP5 Antibody - BSA Free
Immunohistochemistry-Paraffin AKAP5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
HspB7 Antibody
(3E11)
H00027129-M01
Immunohistochemistry-Paraffin HspB7 Antibody (3E11)
Western Blot HspB7 Antibody (3E11)
Sandwich ELISA HspB7 Antibody (3E11)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
RhoB Antibody
NBP2-20154
Western Blot RhoB Antibody
Western Blot RhoB Antibody
Western Blot RhoB Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H1F0 Antibody
(1415-1) - Azide and ...
NBP2-47752
Flow Cytometry H1F0 Antibody (1415-1) - Azide and BSA Free
Immunohistochemistry-Paraffin H1F0 Antibody (1415-1) - Azide and BSA Free
Immunohistochemistry-Paraffin H1F0 Antibody (1415-1) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
HMX1 Antibody
H00003166-B01P-50ug
Western Blot HMX1 Antibody
Western Blot HMX1 Antibody
Species: Hu
Applications: WB
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
HSP10/EPF Antibody
[Unconjugated]
AF2584
Western Blot HSP10/EPF Antibody [Unconjugated]
Simple Western HSP10/EPF Antibody [Unconjugated]
Species: Mu
Applications: Simple Western, WB
HSPB8/HSP22
Recombinant Protein A
NBP1-84945PEP
HSPB8/HSP22 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HSPB8/HSP22 Protein (NBP1-84945PEP) (0)

There are no publications for HSPB8/HSP22 Protein (NBP1-84945PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPB8/HSP22 Protein (NBP1-84945PEP) (0)

There are no reviews for HSPB8/HSP22 Protein (NBP1-84945PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSPB8/HSP22 Protein (NBP1-84945PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSPB8/HSP22 Products

Research Areas for HSPB8/HSP22 Protein (NBP1-84945PEP)

Find related products by research area.

Blogs on HSPB8/HSP22

There are no specific blogs for HSPB8/HSP22, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: HSP27 Antibody (G3.1) [NBP2-32972] - Flow Cytometric Analysis of PFA-fixed MCF-7 cells using HSP27 Antibody (G3.1)followed by Goat anti- Mouse- IgG-CF488 (Blue); Isotype Control (Red).
HSP27 Antibody (G3.1)
NBP2-32972-0.1mg
Western Blot: AlphaB Crystallin/CRYAB Antibody (OTI6A9) [NBP1-47708] - Analysis of extracts (35ug) from 9 different cell lines by usin g anti-Crystallin AB monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
AlphaB Crystallin/CRYAB Antibody (OTI6A9)
NBP1-47708

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSPB8/HSP22 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HSPB8