Reactivity | PfaSpecies Glossary |
Applications | WB, PAGE |
Description | A partial recombinant protein corresponding to bacteria HSP90. Source: E. coli Amino Acid Sequence: QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL |
Localization | Cytoplasm|Melanosome |
Preparation Method |
This protein is affinity purified. |
Protein/Peptide Type | Partial Recombinant Protein |
Gene | HSP90AA1 |
Purity | >85% |
Dilutions |
|
Theoretical MW | 21.4 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | 50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol |
Preservative | No Preservative |
Purity | >85% |
Research Areas for HSP90 Partial Recombinant Protein (NBP3-18321)Find related products by research area.
|
Friends become Foes: Molecular Chaperons, Hsp70 and Hsp90, Cause Muscle Wasting in Cancers By Jamshed Arslan Pharm.D. Muscle atrophy is a common feature of many tumors. Cancer-induced muscle wasting, or cancer cachexia, results from pro-in?ammatory cytokines (TNFa and IL-6) and/or agonists of type IIB ac... Read full blog post. |
HSP90 - an essential eukaryotic protein with implications for drug development The heat-shock protein 90 (HSP90) family is a group of highly conserved molecular chaperones with important functions in protein folding and in signal transduction. The HSP90 protein structure is so well conserved that some HSP90 antibodies are rea... Read full blog post. |
Integrin beta 1 binding protein 2 ITGB1BP2 is a muscle-specific protein cloned by a rat created by Branccio's group in Italy that was found to interact with the cytoplasmic domain of integrin beta 11. It is expressed only in heart and skeletal muscle but is not essential for normal de... Read full blog post. |
HSP Antibodies: Novel Therapies for MMP-induced Metastatic Breast Cancer The matrix metalloproteinases are zinc-dependent protease enzymes which interact with a range of ECM (extracellular matrix) proteins, and are activated by proteolytic cleavage. We at Novus Biologicals offer a wide range of top quality MMP reagents, in... Read full blog post. |
Heat Shock Proteins: An Overview Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis... Read full blog post. |
The Heat is On: Heat Shock Proteins and the Link to Cancer Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | HSP90AA1 |