Novus Biologicals products are now on bio-techne.com

Recombinant P. falciparum HSP90 Protein

Images

 
There are currently no images for HSP90 Partial Recombinant Protein (NBP3-18321).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity PfaSpecies Glossary
Applications WB, PAGE

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant P. falciparum HSP90 Protein Summary

Description
A partial recombinant protein corresponding to bacteria HSP90.

Source: E. coli

Amino Acid Sequence: QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL

Localization
Cytoplasm|Melanosome
Preparation
Method
This protein is affinity purified.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HSP90AA1
Purity
>85%

Applications/Dilutions

Dilutions
  • SDS-Page
  • Western Blot
Theoretical MW
21.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol
Preservative
No Preservative
Purity
>85%

Alternate Names for Recombinant P. falciparum HSP90 Protein

  • FLJ31884
  • Heat shock 86 kDa
  • heat shock 90kD protein 1, alpha
  • heat shock 90kD protein 1, alpha-like 4
  • heat shock 90kD protein, alpha-like 4
  • heat shock 90kDa protein 1, alpha
  • heat shock protein 90kDa alpha (cytosolic), class A member 1
  • heat shock protein HSP 90-alpha
  • Hsp89
  • HSP90
  • HSP90AHSP86
  • HSP90N
  • HSPC1HSP 86
  • HSPCAHSP89A
  • HSPCAL1
  • HSPCAL4
  • HSPN
  • LAP2
  • Renal carcinoma antigen NY-REN-38

Background

Hsp90 has at least 2 isoforms, Hsp90a and Hsp90b which are encoded by separate genes. These ubiquitous and highly conserved proteins account for 1-2% of all cellular proteins in most cells. Hsp90 is part of the cells powerful network of chaperones to fight the deleterious consequences of protein unfolding caused by nonphysiological conditions. However, in the absence of stress, Hsp90 is a necessary component of fundamental cellular processes such as hormone signaling and cell cycle control. In this context several key regulatory proteins such as steroid receptors, cell cycle kinases involved in signal transduction and p53 have been identified as substrates of Hsp90. It has been suggested that Hsp90 acts as a capacitor for morphological evolution by buffering widespread variation, which may affect morphogenic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00010963-M35
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA, WB
1129-ER
Species: Hu
Applications: BA
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
NBP3-18321
Species: Pfa
Applications: WB, PAGE

Publications for HSP90 Partial Recombinant Protein (NBP3-18321) (0)

There are no publications for HSP90 Partial Recombinant Protein (NBP3-18321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP90 Partial Recombinant Protein (NBP3-18321) (0)

There are no reviews for HSP90 Partial Recombinant Protein (NBP3-18321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSP90 Partial Recombinant Protein (NBP3-18321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSP90 Products

Research Areas for HSP90 Partial Recombinant Protein (NBP3-18321)

Find related products by research area.

Blogs on HSP90.

Friends become Foes: Molecular Chaperons, Hsp70 and Hsp90, Cause Muscle Wasting in Cancers
By Jamshed Arslan Pharm.D. Muscle atrophy is a common feature of many tumors. Cancer-induced muscle wasting, or cancer cachexia, results from pro-in?ammatory cytokines (TNFa and IL-6) and/or agonists of type IIB ac...  Read full blog post.

HSP90 - an essential eukaryotic protein with implications for drug development
The heat-shock protein 90 (HSP90) family is a group of highly conserved molecular chaperones with important functions in protein folding and in signal transduction. The HSP90 protein structure is so well conserved that some HSP90 antibodies are rea...  Read full blog post.

Integrin beta 1 binding protein 2
ITGB1BP2 is a muscle-specific protein cloned by a rat created by Branccio's group in Italy that was found to interact with the cytoplasmic domain of integrin beta 11. It is expressed only in heart and skeletal muscle but is not essential for normal de...  Read full blog post.

HSP Antibodies: Novel Therapies for MMP-induced Metastatic Breast Cancer
The matrix metalloproteinases are zinc-dependent protease enzymes which interact with a range of ECM (extracellular matrix) proteins, and are activated by proteolytic cleavage. We at Novus Biologicals offer a wide range of top quality MMP reagents, in...  Read full blog post.

Heat Shock Proteins: An Overview
Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis...  Read full blog post.

The Heat is On: Heat Shock Proteins and the Link to Cancer
Novus Biologicals offers an extensive antibody catalog targeting heat shock proteins (HSPs). A large protein group covering a number of families, the HSPs are functionally related by their dramatic upregulation in response to stress. Stress triggers m...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant P. falciparum HSP90 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSP90AA1