Home » HOXC13 » HOXC13 Proteins » HOXC13 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HOXC13 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HOXC13 Protein (NBP2-47428PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HOXC13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXC13.

Source: E. coli

Amino Acid Sequence: PSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HOXC13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47428.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXC13 Recombinant Protein Antigen

  • homeo box 3G
  • homeo box C13
  • homeobox C13
  • Homeobox protein Hox-3G
  • homeobox protein Hox-C13
  • HOX3
  • HOX3GNUP98/HOXC13

Background

HOXC13 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the development of hair, nail, and filiform papilla.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FoxN1 Antibody
(717008) [Unconjugate
MAB7295
Immunohistochemistry FoxN1 Antibody (717008) [Unconjugated]
Species: Mu
Applications: IHC
HOXA9 Antibody
(9X1L6)
NBP3-15720
Western Blot HOXA9 Antibody (9X1L6)
Immunohistochemistry-Paraffin HOXA9 Antibody (9X1L6)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
HOXD10 Antibody
(OTI1D11)
NBP2-45744
Immunohistochemistry HOXD10 Antibody (OTI1D11)
Immunohistochemistry HOXD10 Antibody (OTI1D11)
Immunohistochemistry HOXD10 Antibody (OTI1D11)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
LEF1 Antibody (3H5)
H00051176-M01
Western Blot LEF1 Antibody (3H5)
Sandwich ELISA LEF1 Antibody (3H5)
Western Blot LEF1 Antibody (3H5)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
HOXA13 Antibody
NBP3-17383
Immunocytochemistry/ Immunofluorescence HOXA13 Antibody
Immunohistochemistry-Paraffin HOXA13 Antibody
Species: Hu
Applications: ICC/IF, IHC-P
HOXD11 Antibody
(6C8)
H00003237-M10
Western Blot HOXD11 Antibody (6C8)
Immunocytochemistry/ Immunofluorescence HOXD11 Antibody (6C8)
Immunohistochemistry-Paraffin HOXD11 Antibody (6C8)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HOXC10 Antibody
NBP2-16874
Immunocytochemistry/ Immunofluorescence HOXC10 Antibody
Immunohistochemistry-Paraffin HOXC10 Antibody
Immunohistochemistry-Paraffin HOXC10 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NUP98 Antibody
NB100-93325
Western Blot NUP98 Antibody
(4 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
HOXD9 Antibody
NBP2-85076
Western Blot HOXD9 Antibody
Western Blot HOXD9 Antibody
Species: Hu
Applications: WB
HOXD4 Antibody
NBP2-49631
Immunohistochemistry-Paraffin HOXD4 Antibody
Immunocytochemistry/ Immunofluorescence HOXD4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HOXD3 Antibody
(1B12)
H00003232-M09
Western Blot HOXD3 Antibody (1B12)
Sandwich ELISA HOXD3 Antibody (1B12)
Immunocytochemistry/ Immunofluorescence HOXD3 Antibody (1B12)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot NXT1 Antibody (4F11)
Immunocytochemistry/ Immunofluorescence NXT1 Antibody (4F11)
Western Blot NXT1 Antibody (4F11)
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
HOXD1 Antibody
(4F4)
H00003231-M01
Western Blot HOXD1 Antibody (4F4)
Immunoprecipitation HOXD1 Antibody (4F4)
Sandwich ELISA HOXD1 Antibody (4F4)
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HOXD8 Antibody
NBP2-27108
Western Blot HOXD8 Antibody
Species: Hu, Mu, Pm
Applications: WB
HOXD13 Antibody
NBP1-52149
Immunocytochemistry/ Immunofluorescence HOXD13 Antibody
Immunocytochemistry/ Immunofluorescence HOXD13 Antibody
Microarray HOXD13 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, MiAr, PEP-ELISA
Lamin B2 Antibody
(2E2F4) - BSA Free
NBP2-61818
ELISA Lamin B2 Antibody (2E2F4) - BSA Free
Flow Cytometry Lamin B2 Antibody (2E2F4) - BSA Free
Immunocytochemistry/ Immunofluorescence Lamin B2 Antibody (2E2F4) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MRPL28 Antibody
(3B9F2)
NBP3-15267
Immunocytochemistry/ Immunofluorescence MRPL28 Antibody (3B9F2)
Immunocytochemistry/ Immunofluorescence MRPL28 Antibody (3B9F2)
Immunoprecipitation MRPL28 Antibody (3B9F2)
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Recombinant Human
KRT35 GST (N-Term) Pr ...
H00003886-P01
Other Recombinant Human KRT35 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for HOXC13 Protein (NBP2-47428PEP) (0)

There are no publications for HOXC13 Protein (NBP2-47428PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC13 Protein (NBP2-47428PEP) (0)

There are no reviews for HOXC13 Protein (NBP2-47428PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HOXC13 Protein (NBP2-47428PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXC13 Products

Array NBP2-47428PEP

Research Areas for HOXC13 Protein (NBP2-47428PEP)

Find related products by research area.

Blogs on HOXC13

There are no specific blogs for HOXC13, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: HOXD13 Antibody [NBP1-52149] - Immunofluorescence analysis of paraformaldehyde fixed HEK293 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing strong nuclear and weak cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL). EB09833 Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear staining. The nuclear stain is DAPI (blue).
HOXD13 Antibody
NBP1-52149

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HOXC13 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HOXC13