Novus Biologicals products are now on bio-techne.com

GTF2H3 Recombinant Protein Antigen

Name: GTF2H3 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-30371PEP
Price: 279 USD

Images

There are currently no images for GTF2H3 Protein (NBP2-30371PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GTF2H3 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF2H3. Source: E. coli Amino Acid Sequence: LNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	GTF2H3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30371. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF2H3 Recombinant Protein Antigen

Basic transcription factor 2 34 kDa subunit
BTF2 p34
BTF2
General transcription factor IIH polypeptide 3
general transcription factor IIH subunit 3
general transcription factor IIH, polypeptide 3 (34kD subunit)
general transcription factor IIH, polypeptide 3, 34kDa
TFB4
TFIIH basal transcription factor complex p34 subunit
TFIIH

Background

GTF2H3 is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNAand, when complexed to CAK, in RNA transcription by RNA polymerase II. Anchors XPB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC2/CDK1 Antibody

NBP1-85729

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

DNA Polymerase
delta, catalytic subu ...

NBP2-33466

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

XPD Antibody

AF3296

(1 Publication)

Species: Hu, Mu, Rt

Applications: WB

Cdk7 Antibody

NB100-581

Species: Hu, Mu, Rt

Applications: ICC, IHC, IP, WB

XPB Antibody

NB100-61060

(1 Review)

(3 Publications)

Species: Hu, Mu, Rb, V-Vi

Applications: ChIP, IP, WB

Cyclin H Antibody
(1B8)

H00000902-M01

Immunocytochemistry/ Immunofluorescence Cyclin H Antibody (1B8)

Immunohistochemistry-Paraffin Cyclin H Antibody (1B8)

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

LXR beta/NR1H2
Antibody

NB100-74457

Immunocytochemistry/ Immunofluorescence LXR beta/NR1H2 Antibody

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Recombinant Human
TATA binding protein ...

H00006908-Q01

(5 Publications)

Species: Hu

Applications: ELISA, AP, PA, PAGE, WB

Cyclin B1 Antibody
[Unconjugated]

AF6000

Western Blot Cyclin B1 Antibody [Unconjugated]

Simple Western Cyclin B1 Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: IHC, Simple Western, WB

GTF2H1 Antibody
(1F12-1B5)

H00002965-M01

Immunocytochemistry/ Immunofluorescence GTF2H1 Antibody (1F12-1B5)

Immunohistochemistry-Paraffin GTF2H1 Antibody (1F12-1B5)

(2 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB

p62/SQSTM1
Antibody (2C11)

H00008878-M01

(9 Reviews)

(413 Publications)

Species: Bv, Ha, Hu, Mu, Rb, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

RAP74 Antibody
(OTI4B10)

NBP3-17971

Immunohistochemistry RAP74 Antibody (OTI4B10)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, IHC, IHC-P, WB

XPG Antibody

NB100-74611

Immunohistochemistry-Paraffin XPG Antibody

(5 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, WB

DDR1 Antibody
[Unconjugated]

AF2396

Simple Western DDR1 Antibody [Unconjugated]

Immunohistochemistry DDR1 Antibody [Unconjugated]

(1 Review)

(12 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

PCNA Antibody
(PC10)

NB500-106

(5 Reviews)

(46 Publications)

Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze

Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

RAP30 Antibody

NBP3-17973

Immunocytochemistry/ Immunofluorescence RAP30 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

SAM68 Antibody

NBP1-19151

(1 Review)

(2 Publications)

Species: Bv, Hu, Ma

Applications: ICC/IF, IHC, IHC-P, IP, WB

NUP62 Antibody

NBP1-31381

Immunocytochemistry/ Immunofluorescence NUP62 Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GTF2H3 Protein (NBP2-30371PEP) (0)

There are no publications for GTF2H3 Protein (NBP2-30371PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H3 Protein (NBP2-30371PEP) (0)

There are no reviews for GTF2H3 Protein (NBP2-30371PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF2H3 Protein (NBP2-30371PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2H3 Products

Research Areas for GTF2H3 Protein (NBP2-30371PEP)

Find related products by research area.

Blogs on GTF2H3

There are no specific blogs for GTF2H3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

p62/SQSTM1 Antibody (2C11)
H00008878-M01

PCNA Antibody (PC10)
NB500-106

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our GTF2H3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

GTF2H3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

GTF2H3 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

GTF2H3 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for GTF2H3 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for GTF2H3 Protein (NBP2-30371PEP) (0)

Reviews for GTF2H3 Protein (NBP2-30371PEP) (0)

FAQs for GTF2H3 Protein (NBP2-30371PEP) (0)

Additional GTF2H3 Products

Research Areas for GTF2H3 Protein (NBP2-30371PEP)

Blogs on GTF2H3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics